Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr04070xopAXFF4834R_chr04070Xanthomonas outer protein A, type III effector XopA

xopA XFF4834R_chr04070
XFF4834R_chr_0445
XFF4834R_chr_0445
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04080
XFF4834R_chr04080
ID xopA
AC XFF4834R_chr04070
LT XFF4834R_chr04070
OR XFF4834R_chr from 456797 to 457198 on strand -
DE Xanthomonas outer protein A, type III effector XopA
IP
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro


Curated
PM
AN Also called harpin, HpaG or Hpa1.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20110713)
MW 13346.4 Da
SQ 133 aa
 
........10........20........30........40........50
| | | | |
MMNSLNTQLGANSSFLQVDPSQNTQTGSNQGNQGISEKQLDQLLTQLIMA
LLQQSNNADEGQGQGGTSGSGQGGNPQQAGQSNGSPSQYTQMLMNIVGDI
LQAQNGGGFGGGFGGGFGGSLGTSLASDTGSMQ
Show or not Domain decomposition
 
X.species

NP_640771.1 lcl|hpa1-XAC0416

2

105

S=256 I=59 E=1.53833e-24

Hpa1 protein

X.species

YP_362171.1 lcl|xopA-XCV0440

1

133

S=179 I=42 E=3.14822e-15

outer protein A

pubmed

2

133

S=278 I=55 E=1.19296e-25

HpaG

Pubmed 12730176

 

prodomImg

pubmed

2

133

S=182 I=42 E=4.68709e-14

Hypersensitive response-functioning factor A

Pubmed 15623159

 

prodomImg

pubmed

2

133

S=181 I=42 E=5.53156e-14

Hpa1 Hpa1 homolog Hpa1 protein Hypersensitive response-functioning factor A

Pubmed 10714988,15623159

 

prodomImg

pubmed

1

133

S=179 I=42 E=1.03628e-13

XopA

Pubmed 8664494,11844763

 

prodomImg

pubmed

2

133

S=162 I=41 E=1.40371e-11

HpaGXooc

Pubmed 18943492

 

prodomImg

Iprscan [seg]

21

34

-

Iprscan [seg]

61

85

-

Iprscan [seg]

106

119

-

PD197673

2

133

S=205 I=45 E=2.48136e-17

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one MlptX7n5)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBc5P5qm/XFF4834R_chr04070.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBc5P5qm/XFF4834R_chr04070.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBc5P5qm/XFF4834R_chr04070.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBc5P5qm/XFF4834R_chr04070.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.