Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr04040hrcCXFF4834R_chr04040type III secretion system protein HrcC

hrcC XFF4834R_chr04040
XFF4834R_chr04030
XFF4834R_chr04030
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04060
XFF4834R_chr04060
ID hrcC
AC XFF4834R_chr04040
LT XFF4834R_chr04040
OR XFF4834R_chr from 453083 to 454906 on strand +
DE type III secretion system protein HrcC
IP Type III secretion system outer membrane pore YscC/HrcC
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro
Biological Process: protein secretion (GO:0009306)
Molecular Function: protein transporter activity (GO:0008565)

Curated
PM
AN
CC COG: [NU] Cell motility;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100512)
MW 64004.4 Da
SQ 607 aa
 
........10........20........30........40........50
| | | | |
MAPACTTAHRRRAPLAAVLMLSLLPLLSPHADAAQVPWHSRTFKYVADNK
DLKEVLRDLSASQSIATWISPEVTGTLSGKFETSPQKFLDDLAATYGFVW
YYDGAVLRIWGANESKSATLSLGTASTKSLRDALARMRLDDPRFPVRYDE
AAHVAVVSGPPGYVDTVSAIAKQVEQGARQRDATEVQVFQLHYAQAVDHT
TRIGGQDVQIPGMASLLRSMYGARGAPVAAIPGPSANFGRVQPIGGGSSN
TFGNAAPGQGGGANGILGLPSSWFGGTSSSDRVPVSPPLPGSGAAAAAGS
PASVWPELSKGRRDESNPIDAGGGAELASDAPVIEADPRTNAILIRDRPE
RMQSYGTLIQQLDNRPKLLQIDATIIEIRDGAMQDLGVDWRFHSQHTDIQ
TGDGRGGQLGFNGALSGAATDGATTPVGGTLTAVLGDAGRYLMTRVSALE
TTNKAKIVSSPQVATLDNVEAVMDHKQQAFVRVSGYASADLYNLSAGVSL
RVLPSVVPGSPNGQMRLDVRIEDGQLGSNTVDGIPVITSSEITTQAFVNE
GQSLLIAGYAYDADETDLNAVPGLSKIPLLGNLFKHRQKSGSRMQRLFLL
TPHVVSP
XFF4834R

XFF4834R_chr34280 lcl|XFF4834R_chr37230162_3965450_r2_XFF4834R-XFF4834R_chr34280

317

605

S=198 I=26 E=3.81555e-17

XFF4834R

XFF4834R_chr07040 lcl|gspD-XFF4834R_chr07040

446

605

S=99 I=22 E=3.31442e-05

general secretory pathway component, cryptic

XFF4834R

XFF4834R_chr34280 lcl|XFF4834R_chr37230162_3965450_r2_XFF4834R-XFF4834R_chr34280

317

605

S=198 I=26 E=3.81555e-17

XFF4834R

XFF4834R_chr07040 lcl|gspD-XFF4834R_chr07040

446

605

S=99 I=22 E=3.31442e-05

general secretory pathway component, cryptic

X.species

YP_362166.1 lcl|hrcC-XCV0435

1

607

S=2759 I=88 E=0

HrcC protein

X.species

NP_640770.1 lcl|hrcC-XAC0415

1

607

S=2742 I=88 E=0

HrcC protein

X.species

NP_636613.1 lcl|hrcC-XCC1239

1

607

S=2342 I=77 E=0

HrcC protein

X.species

lcl|xsaO-XALc_1491

337

605

S=233 I=28 E=7.2217e-21

probable xanthomonas secretion apparatus protein

X.species

lcl|xsaO-XALc_1491

44

223

S=176 I=28 E=5.77348e-14

probable xanthomonas secretion apparatus protein

X.species

NP_643841.1 lcl|xpsD-XAC3534

317

605

S=200 I=27 E=8.7195e-17

general secretion pathway protein D

X.species

lcl|pilQ-XALc_2349

334

605

S=195 I=25 E=3.36822e-16

probable type iv pilus assembly protein pilq

X.species

NP_643688.1 lcl|pilQ-XAC3381

336

605

S=188 I=24 E=2.27324e-15

fimbrial assembly protein

X.species

NP_636062.1 lcl|xpsD-XCC0670

326

605

S=187 I=25 E=2.70629e-15

general secretion pathway protein D

X.species

YP_365389.1 lcl|xpsD-XCV3658

326

605

S=178 I=25 E=3.19121e-14

type II secretory pathway component

X.species

lcl|xpsD-XALc_2654

317

605

S=168 I=24 E=5.97339e-13

probable general secretion pathway protein d

X.species

YP_365228.1 lcl|pilQ-XCV3497

336

605

S=159 I=24 E=6.34401e-12

fimbrial assembly protein

X.species

NP_638574.1 lcl|pilQ-XCC3228

442

605

S=140 I=25 E=1.56832e-09

fimbrial assembly protein

pubmed

1

607

S=2785 I=89 E=0

HrcC ; Transport

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

607

S=2759 I=88 E=0

Hypersensitivity response secretion protein hrpA1 ; Cell membrane outer Hypersensitive elicitation transport Signal Translocation Virulence

Pubmed 1472717

 

prodomImg

pubmed

1

607

S=2739 I=88 E=0

HrcC ; Transport

Pubmed 12730176

 

prodomImg

pubmed

1

607

S=2687 I=87 E=0

HrcC HrcC protein HrpA ; Transport

Pubmed 10714988,15623159

 

prodomImg

pubmed

1

607

S=2658 I=86 E=0

HrcC ; Transport

Pubmed 16957248

 

prodomImg

pubmed

330

607

S=752 I=53 E=3.65003e-82

SctC ; Transport

Pubmed 10403415,11990489

 

prodomImg

pubmed

36

252

S=460 I=42 E=8.70189e-47

SctC ; Transport

Pubmed 10403415,11990489

 

prodomImg

pubmed

332

607

S=729 I=50 E=2.68337e-79

Hypersensitivity response secretion protein hrpA ; Cell membrane outer Hypersensitive elicitation Plasmid transport Signal Translocation

Pubmed 1472716,7623665

 

prodomImg

pubmed

36

250

S=527 I=48 E=7.04453e-55

Hypersensitivity response secretion protein hrpA ; Cell membrane outer Hypersensitive elicitation Plasmid transport Signal Translocation

Pubmed 1472716,7623665

 

prodomImg

pubmed

332

606

S=562 I=42 E=4.65105e-59

BcscC ; Transport

Pubmed 15183868

 

prodomImg

sp

1

607

S=2759 I=88 E=0

Hypersensitivity response secretion protein hrpA1 ; Cell membrane outer Hypersensitive elicitation transport Signal Translocation Virulence

 

prodomImg

sp

332

607

S=729 I=50 E=1.84768e-79

Hypersensitivity response secretion protein hrpA ; Cell membrane outer Hypersensitive elicitation Plasmid transport Signal Translocation

 

prodomImg

sp

36

250

S=527 I=48 E=4.85063e-55

Hypersensitivity response secretion protein hrpA ; Cell membrane outer Hypersensitive elicitation Plasmid transport Signal Translocation

 

prodomImg

sp

324

605

S=412 I=35 E=3.95747e-41

Yop proteins translocation protein C ; Cell membrane outer Plasmid transport Signal

 

prodomImg

sp

35

220

S=280 I=34 E=3.87104e-25

Yop proteins translocation protein C ; Cell membrane outer Plasmid transport Signal

 

prodomImg

Iprscan IPR003522 [PR01337]

45

59

Type III secretion system outer membrane pore YscC/HrcC

Iprscan IPR003522 [PR01337]

85

101

Type III secretion system outer membrane pore YscC/HrcC

Iprscan IPR003522 [PR01337]

159

175

Type III secretion system outer membrane pore YscC/HrcC

Iprscan IPR003522 [PR01337]

198

215

Type III secretion system outer membrane pore YscC/HrcC

Iprscan IPR003522 [PR01337]

370

390

Type III secretion system outer membrane pore YscC/HrcC

Iprscan IPR003522 [PR01337]

461

480

Type III secretion system outer membrane pore YscC/HrcC

Iprscan IPR003522 [PR01337]

495

510

Type III secretion system outer membrane pore YscC/HrcC

Iprscan IPR003522 [PR01337]

584

603

Type III secretion system outer membrane pore YscC/HrcC

Iprscan IPR005644 [PF03958]

186

367

NolW-like

Iprscan IPR004846 [PF00263]

448

605

Type II/III secretion system

Iprscan IPR003522 [TIGR02516]

42

607

Type III secretion system outer membrane pore YscC/HrcC

Iprscan IPR004845 [PS00875]

551

584

Type II secretion system gspD, conserved site

PD004370

36

216

S=477 I=52 E=2.90799e-50

PD712417

395

436

S=200 I=98 E=1.30096e-16

PD864940

437

507

S=193 I=54 E=7.57072e-16

PD004670

334

390

S=144 I=46 E=7.2747e-10

PD001316

535

605

S=129 I=31 E=4.94861e-08

PD119296

180

282

S=125 I=33 E=1.32544e-07

PD574368

338

536

S=110 I=26 E=9.92381e-06

PDA0Y0U5

186

225

S=105 I=53 E=3.60646e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one TgtGGTI0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

131 hits
swiss-prot

Swiss-Prot ncbi-blastp

40 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxgi5tM/XFF4834R_chr04040.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxgi5tM/XFF4834R_chr04040.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxgi5tM/XFF4834R_chr04040.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxgi5tM/XFF4834R_chr04040.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.