Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr04030hrcTXFF4834R_chr04030type III secretion apparatus protein HrcT

hrcT XFF4834R_chr04030
XFF4834R_chr04020
XFF4834R_chr04020
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04040
XFF4834R_chr04040
ID hrcT
AC XFF4834R_chr04030
LT XFF4834R_chr04030
OR XFF4834R_chr from 452171 to 453001 on strand +
DE type III secretion apparatus protein HrcT
IP Type III secretion system inner membrane R protein; Type III secretion protein SpaR/YscT
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro
Biological Process: protein targeting (GO:0006605)
Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Cellular Component: integral to membrane (GO:0016021)

Curated
PM
AN
CC COG: [U] Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101118)
MW 28888.7 Da
SQ 276 aa
 
........10........20........30........40........50
| | | | |
MNDATDALLAISSQGVSLLTLLALCGVRVFVMFTVLPATAQDSLPGIARN
GVIYVLSSFIAYGQPADALAKIQTVGLVGVVFKEAFIGLMIGFAASTVFW
IAESVGLLIDDLAGYNNVQMTNPLSGQQSTPVSTVLLQLAIVSFYALGGM
LMLLGALFESFRWWPLSQLGPNVGAVAESFVIQQSDGMMAAVVKLSAPVM
LVLVLVDLAIGLVARAADKLEPSNLSQPIRGVLALLLLALLTSVFIAQFG
EALGFLHFQQQLHDAANVGGKGAASH
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr20710 lcl|fliR-XFF4834R_chr20710

27

228

S=102 I=23 E=6.2649e-06

flagellar export pore protein

X.species

NP_640769.1 lcl|hrcT-XAC0414

1

276

S=1197 I=90 E=4.48959e-138

HrcT protein

X.species

YP_362165.1 lcl|hrcT-XCV0434

1

276

S=1178 I=88 E=8.17993e-136

HrcT protein

X.species

NP_636612.1 lcl|hrcT-XCC1238

1

276

S=1074 I=79 E=4.1712e-123

HrpB8 protein

X.species

YP_363717.1 lcl|fliR-XCV1986

27

228

S=102 I=23 E=2.44422e-05

flagellar biosynthesis pathway component FliR

X.species

NP_642267.1 lcl|fliR-XAC1941

27

228

S=99 I=23 E=5.64474e-05

flagellar biosynthetic protein

X.species

lcl|fliR-XALc_1384

81

229

S=99 I=25 E=5.84507e-05

probable flagellar biosynthetic protein flir

X.species

NP_637279.1 lcl|fliR-XCC1914

83

228

S=98 I=25 E=7.79372e-05

flagellar biosynthetic protein

pubmed

1

276

S=1227 I=92 E=4.42241e-140

HrcT ; Transmembrane

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

276

S=1197 I=90 E=1.67458e-136

HrcT ; Transmembrane

Pubmed 12730176

 

prodomImg

pubmed

1

276

S=1178 I=88 E=3.05105e-134

HrpB8 ; Transmembrane

Pubmed 8664494,8576039

 

prodomImg

pubmed

1

276

S=1172 I=88 E=1.88725e-133

HrcT HrpB8 ; Transmembrane

Pubmed 11410350

 

prodomImg

pubmed

1

276

S=1157 I=87 E=1.29504e-131

HrpB8 ; Transmembrane

Pubmed 16957248

 

prodomImg

pubmed

27

263

S=557 I=44 E=5.55934e-59

HrpC protein ; Transmembrane

Pubmed 1479894,1472716

 

prodomImg

pubmed

34

272

S=493 I=40 E=3.6978e-51

Putative transmembrane protein SctT

Pubmed 10403415,11990489

 

prodomImg

pubmed

31

230

S=285 I=35 E=4.87099e-26

BcscT ; Transmembrane

Pubmed 15183868

 

prodomImg

pubmed

28

230

S=280 I=32 E=2.57537e-25

BcscT ; Transmembrane

Pubmed 11557147,12595458

 

prodomImg

pubmed

28

230

S=228 I=32 E=4.24894e-19

AscT ; Transmembrane

Pubmed 15528564

 

prodomImg

sp

33

231

S=205 I=26 E=2.02526e-16

Yop proteins translocation protein T ; Cell membrane Plasmid transport Transmembrane Virulence

 

prodomImg

sp

33

231

S=205 I=26 E=2.02526e-16

Yop proteins translocation protein T ; Cell membrane Plasmid transport Transmembrane Virulence

 

prodomImg

sp

16

230

S=162 I=25 E=3.03832e-11

Flagellar biosynthetic protein fliR ; Bacterial flagellum Cell membrane Transmembrane

 

prodomImg

Iprscan IPR002010 [PR00953]

87

106

Type III secretion system inner membrane R protein

Iprscan IPR002010 [PR00953]

189

211

Type III secretion system inner membrane R protein

Iprscan IPR002010 [PR00953]

211

230

Type III secretion system inner membrane R protein

Iprscan IPR002010 [PR00953]

28

49

Type III secretion system inner membrane R protein

Iprscan IPR002010 [PF01311]

13

261

Type III secretion system inner membrane R protein

Iprscan IPR006304 [TIGR01401]

12

265

Type III secretion protein SpaR/YscT

PD075816

230

276

S=178 I=77 E=4.25265e-14

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Pu8jo4wW)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

37 hits
swiss-prot

Swiss-Prot ncbi-blastp

6 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBx9KeoL/XFF4834R_chr04030.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBx9KeoL/XFF4834R_chr04030.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBx9KeoL/XFF4834R_chr04030.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBx9KeoL/XFF4834R_chr04030.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.