Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr04020HrpB7XFF4834R_chr04020HrpB7 protein, type III secretion system

HrpB7 XFF4834R_chr04020
XFF4834R_chr04010
XFF4834R_chr04010
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04030
XFF4834R_chr04030
ID HrpB7
AC XFF4834R_chr04020
LT XFF4834R_chr04020
OR XFF4834R_chr from 451665 to 452174 on strand +
DE HrpB7 protein, type III secretion system
IP Type III secretion protein HrpB7
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro


Curated
PM
AN
CC COG: [DS] Cell cycle control, cell division, chromosome partitioning;Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110711)
MW 18603.6 Da
SQ 169 aa
 
........10........20........30........40........50
| | | | |
MRESARTWSVLHQLKARRCERMQERLNDCTRALEHCDRELASCRQQAQAC
TTRLANCDAALMDKAGVGGSIDIDTILQHERFRTVLVEACRAAEQAQAAA
SQSLQSARDELASVQQALSKLQAQAQAYADKAASARRARQAQREAAEEED
AIEALVALRSHRTAQGGAR
Show or not Domain decomposition
 
X.species

NP_640768.1 lcl|hrpB7-XAC0413

1

169

S=455 I=59 E=2.08634e-48

HrpB7 protein

X.species

YP_362164.1 lcl|hrpB7-XCV0433

1

169

S=438 I=57 E=1.87595e-46

HrpB7 protein

X.species

NP_636611.1 lcl|hrpB7-XCC1237

1

90

S=237 I=64 E=5.23477e-22

HrpB7 protein

pubmed

1

169

S=523 I=64 E=3.66659e-55

HrpB7

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

168

S=455 I=59 E=5.43926e-47

HrpB7

Pubmed 12730176

 

prodomImg

pubmed

1

169

S=438 I=57 E=6.24308e-45

HrpB7

Pubmed 1472717,8664494

 

prodomImg

pubmed

1

169

S=419 I=57 E=1.39005e-42

HrpB7

Pubmed 11410350

 

prodomImg

pubmed

1

169

S=404 I=54 E=8.74222e-41

HrpB7

Pubmed 16957248

 

prodomImg

Iprscan IPR013392 [PF09486]

3

160

Type III secretion protein HrpB7

Iprscan IPR013392 [TIGR02559]

3

160

Type III secretion protein HrpB7

PD092026

1

90

S=344 I=74 E=3.70522e-34

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one bR7vbKEU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgRcVw8/XFF4834R_chr04020.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgRcVw8/XFF4834R_chr04020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgRcVw8/XFF4834R_chr04020.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgRcVw8/XFF4834R_chr04020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.