Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr04010hrcNXFF4834R_chr04010type III secretion system ATPase

hrcN XFF4834R_chr04010
XFF4834R_chr04000
XFF4834R_chr04000
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04020
XFF4834R_chr04020
ID hrcN
AC XFF4834R_chr04010
LT XFF4834R_chr04010
OR XFF4834R_chr from 450344 to 451672 on strand +
DE type III secretion system ATPase
IP ATPase, type III secretion system, FliI/YscN
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro
Biological Process: proton transport (GO:0015992)
Biological Process: ATP metabolic process (GO:0046034)
Biological Process: protein secretion by the type III secretion system (GO:0030254)
Biological Process: ATP biosynthetic process (GO:0006754)
Biological Process: ATP synthesis coupled proton transport (GO:0015986)
Biological Process: biosynthetic process (GO:0009058)
Cellular Component: cytoplasm (GO:0005737)
Cellular Component: proton-transporting two-sector ATPase complex (GO:0016469)
Cellular Component: type III protein secretion system complex (GO:0030257)
Molecular Function: ATPase activity (GO:0016887)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: nucleotide binding (GO:0000166)
Molecular Function: nucleoside-triphosphatase activity (GO:0017111)
catalytic domain (GO:0033178)
catalyzing transmembrane movement of substances (GO:0016820)
rotational mechanism (GO:0046961)
rotational mechanism (GO:0046933)

Curated
PM
AN
CC COG: [NU] Cell motility;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100512)
MW 47670.1 Da
SQ 442 aa
 
........10........20........30........40........50
| | | | |
MLAETPLLETTLERELATLAFGRRYGKVVEVVGTMLKVAGVQVSLGEVCE
LRQRDGTLLQRAEVVGFSRDLALLAPFGELVGLSRETRVIGLGRPLAVPV
GPALLGRVLDGLGEPSDGQGAIACDTWVPIQAQAPDPMRRRLIEQPMPTG
VRIVDGLTTLGEGQRMGIFAAAGVGKSTLMGMFARGTQCDVNVIVLIGER
GREVREFIELILGADGLARSVVVCATSDRSSIERAKAAYVGTAIAEYFRD
RGLRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERA
GMGENGSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAAKNQYP
AIDVLASLSRVMSQIVPSDHSQAARQLRRLLAKYNEVETLVQVGEYRQGS
DAVADEAIDRIDAIRDFLSQPTDQLSAYDSTLEQLASVTDDA
XFF4834R

XFF4834R_chr20800 lcl|fliI-XFF4834R_chr20800

24

400

S=869 I=50 E=1.1542e-98

flagellum-specific ATP synthase

XFF4834R

XFF4834R_chr35450 lcl|atpD-XFF4834R_chr35450

26

393

S=390 I=30 E=1.2316e-40

F1 sector of membrane-bound ATP synthase, beta subunit

XFF4834R

XFF4834R_chr35470 lcl|atpA-XFF4834R_chr35470

23

392

S=363 I=30 E=2.62306e-37

F1 sector of membrane-bound ATP synthase, alpha subunit

XFF4834R

XFF4834R_chr37230 lcl|rho-XFF4834R_chr37230

152

390

S=173 I=29 E=2.7351e-14

transcription termination factor

XFF4834R

XFF4834R_chr20800 lcl|fliI-XFF4834R_chr20800

24

400

S=869 I=50 E=1.1542e-98

flagellum-specific ATP synthase

XFF4834R

XFF4834R_chr35450 lcl|atpD-XFF4834R_chr35450

26

393

S=390 I=30 E=1.2316e-40

F1 sector of membrane-bound ATP synthase, beta subunit

XFF4834R

XFF4834R_chr35470 lcl|atpA-XFF4834R_chr35470

23

392

S=363 I=30 E=2.62306e-37

F1 sector of membrane-bound ATP synthase, alpha subunit

XFF4834R

XFF4834R_chr37230 lcl|rho-XFF4834R_chr37230

152

390

S=173 I=29 E=2.7351e-14

transcription termination factor

X.species

NP_640767.1 lcl|hrcN-XAC0412

21

442

S=2024 I=95 E=0

type III secretion system ATPase

X.species

YP_362163.1 lcl|hrcN-XCV0432

22

442

S=1999 I=94 E=0

type III secretion system ATPase

X.species

NP_636610.1 lcl|hrcN-XCC1236

21

442

S=1884 I=88 E=0

type III secretion system ATPase

X.species

NP_637288.1 lcl|fliI-XCC1923

24

435

S=881 I=48 E=1.77129e-99

flagellar protein

X.species

lcl|fliI-XALc_1393

24

400

S=876 I=50 E=6.00344e-99

probable flagellum-specific atp synthase protein

X.species

YP_363726.1 lcl|fliI-XCV1995

24

400

S=869 I=50 E=4.38252e-98

flagellar biosynthesis/type III secretory pathway ATPase FliI

X.species

NP_642277.1 lcl|fliI-XAC1951

24

400

S=869 I=50 E=4.61788e-98

flagellar protein

X.species

lcl|xsaS-XALc_1495

26

400

S=679 I=41 E=4.60971e-75

probable xanthomonas secretion apparatus protein

X.species

lcl|atpD-XALc_2906

26

393

S=415 I=30 E=4.85453e-43

probable atp synthase , beta subunit protein

X.species

YP_365498.1 lcl|atpD-XCV3767

26

393

S=391 I=30 E=3.9281e-40

F0F1 ATP synthase subunit beta

X.species

NP_643956.1 lcl|atpD-XAC3649

26

393

S=390 I=30 E=4.67641e-40

F0F1 ATP synthase subunit beta

X.species

NP_635946.1 lcl|atpD-XCC0554

26

393

S=389 I=30 E=6.9838e-40

F0F1 ATP synthase subunit beta

X.species

NP_635944.1 lcl|atpA-XCC0552

23

392

S=363 I=30 E=8.36605e-37

F0F1 ATP synthase subunit alpha

X.species

YP_365500.1 lcl|atpA-XCV3769

23

392

S=363 I=30 E=9.87334e-37

F0F1 ATP synthase subunit alpha

X.species

NP_643958.1 lcl|atpA-XAC3651

23

392

S=363 I=30 E=9.87334e-37

F0F1 ATP synthase subunit alpha

X.species

lcl|atpA-XALc_2908

23

392

S=354 I=30 E=1.05778e-35

probable atp synthase, alpha subunit protein

X.species

lcl|Rho-XALc_2882

152

390

S=180 I=29 E=1.49903e-14

putative transcription termination factor rho protein

X.species

NP_639123.1 lcl|rho-XCC3778

152

387

S=174 I=29 E=8.35126e-14

transcription termination factor Rho

X.species

NP_644137.1 lcl|rho-XAC3831

152

387

S=174 I=29 E=8.35126e-14

transcription termination factor Rho

X.species

YP_365687.1 lcl|rho-XCV3956

152

387

S=173 I=29 E=1.01171e-13

transcription termination factor Rho

pubmed

21

442

S=2062 I=96 E=0

HrcN ; ATP-binding Nucleotide-binding

Pubmed 15812033,18326683

 

prodomImg

pubmed

21

442

S=2025 I=95 E=0

HrcN ; ATP-binding Nucleotide-binding

Pubmed 12730176

 

prodomImg

pubmed

21

442

S=2012 I=94 E=0

HrcN HrcN protein HrpB6 ; ATP-binding Nucleotide-binding

Pubmed 11410350

 

prodomImg

pubmed

21

442

S=2004 I=94 E=0

HrpB6 ; ATP-binding Nucleotide-binding

Pubmed 16957248

 

prodomImg

pubmed

22

442

S=1999 I=94 E=0

Probable ATP synthase hrpB6 EC=3.6.3.14 ; synthesis ATP-binding Cytoplasm Hydrogen ion transport Hydrolase Hypersensitive response elicitation Nucle

Pubmed 1472717

 

prodomImg

pubmed

23

431

S=1489 I=70 E=1.36354e-171

HrpE protein ; ATP-binding Nucleotide-binding

Pubmed 1479894,1472716

 

prodomImg

pubmed

24

439

S=1440 I=70 E=1.28758e-165

SctN ; ATP-binding Nucleotide-binding

Pubmed 10403415,11990489

 

prodomImg

pubmed

26

441

S=1223 I=59 E=2.42288e-139

BcscN ; ATP-binding Nucleotide-binding

Pubmed 15183868

 

prodomImg

pubmed

23

438

S=1217 I=57 E=1.24794e-138

BscN ; ATP-binding Nucleotide-binding

Pubmed 9663681

 

prodomImg

pubmed

26

441

S=1213 I=59 E=3.8095e-138

BcscN ; ATP-binding Nucleotide-binding

Pubmed 11557147,12595458

 

prodomImg

sp

22

442

S=1999 I=94 E=0

Probable ATP synthase hrpB6 EC=3.6.3.14 ; synthesis ATP-binding Cytoplasm Hydrogen ion transport Hydrolase Hypersensitive response elicitation Nucle

 

prodomImg

sp

26

439

S=1185 I=57 E=5.98887e-135

Probable ATP synthase yscN EC=3.6.3.14 ; synthesis ATP-binding Cytoplasm Hydrogen ion transport Hydrolase Nucleotide-binding Plasmid Protein

 

prodomImg

sp

26

439

S=1185 I=57 E=7.12976e-135

Probable ATP synthase yscN EC=3.6.3.14 ; synthesis ATP-binding Cytoplasm Hydrogen ion transport Hydrolase Nucleotide-binding Plasmid Protein V

 

prodomImg

sp

26

439

S=1081 I=53 E=2.52088e-122

Probable ATP synthase y4yI EC=3.6.3.14 ; synthesis ATP-binding Cytoplasm Hydrogen ion transport Hydrolase Nucleotide-binding Plasmid

 

prodomImg

sp

23

441

S=1033 I=50 E=1.55281e-116

Flagellum-specific ATP synthase EC=3.6.3.14 ; synthesis ATP-binding Bacterial biogenesis protein export Cytoplasm Hydrogen ion transport Hydrol

 

prodomImg

Iprscan [G3DSA:3.40.50.300]

95

366

-

Iprscan [PTHR15184:SF9]

4

390

-

Iprscan [PTHR15184]

4

390

-

Iprscan IPR004100 [PF02874]

28

93

ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal

Iprscan IPR000194 [PF00006]

149

359

ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain

Iprscan IPR003593 [SM00382]

162

344

ATPase, AAA+ type, core

Iprscan IPR013380 [TIGR02546]

20

440

ATPase, type III secretion system, H+-transporting

Iprscan IPR005714 [TIGR01026]

2

440

ATPase, type III secretion system, FliI/YscN

Iprscan IPR020003 [PS00152]

350

359

ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain, active site

PD889941

166

216

S=177 I=75 E=6.64542e-14

PDA1D9M5

261

365

S=160 I=37 E=6.57674e-12

PDA1F756

261

294

S=155 I=88 E=3.15923e-11

PD650473

368

438

S=145 I=42 E=5.0989e-10

PDA1F728

295

332

S=131 I=75 E=2.26259e-08

PD004116

188

360

S=126 I=29 E=1.03147e-07

PD030586

23

100

S=120 I=37 E=4.62101e-07

PD969851

96

165

S=119 I=33 E=7.14599e-07

PD856741

333

362

S=118 I=73 E=8.50731e-07

PDA33341

219

269

S=117 I=39 E=1.17461e-06

Iprscan [SSF52540]

96

366

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one FoFM4up1)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaRp7Rp/XFF4834R_chr04010.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaRp7Rp/XFF4834R_chr04010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaRp7Rp/XFF4834R_chr04010.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaRp7Rp/XFF4834R_chr04010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.