Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr04000hrpB5XFF4834R_chr04000type III secretion system protein HrpB5

hrpB5 XFF4834R_chr04000
XFF4834R_chr03990
XFF4834R_chr03990
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04010
XFF4834R_chr04010
ID hrpB5
AC XFF4834R_chr04000
LT XFF4834R_chr04000
OR XFF4834R_chr from 449653 to 450354 on strand +
DE type III secretion system protein HrpB5
IP Type III secretion system HrpE/YscL
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro


Curated
PM
AN
CC COG: [NU] Cell motility;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100512)
MW 25215 Da
SQ 233 aa
 
........10........20........30........40........50
| | | | |
MRLWLRSTPDAIGLDCDVIPREALASVLALDAATAEVHARCEQALSQAQT
RAQALIDEAQQQAEAILHDARQKAERSARLGYAAGLRRQLDEWNESGLRH
AFAAETAAQRARERLAGIVARTCEHIILGHDPAALYARAAQALEGALDEA
KALRVSVHPDAVDAARRAFDAAATEAGWTLQVELCGDADLAVGACVCEWD
TGVFETDLRDQLRSLRRVIRRVLAAPQEPVDAG
Show or not Domain decomposition
 
X.species

NP_640766.1 lcl|hrpB5-XAC0411

1

233

S=802 I=72 E=2.9235e-90

type III secretion system protein HrpB

X.species

YP_362162.1 lcl|hrcL-XCV0431

1

233

S=789 I=71 E=9.23334e-89

type III secretion system protein HrpB

X.species

NP_636609.1 lcl|hrpB5-XCC1235

1

232

S=589 I=55 E=1.72527e-64

type III secretion system protein HrpB

pubmed

1

233

S=815 I=73 E=2.74931e-90

HrpB5

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

233

S=802 I=72 E=1.06113e-88

HrpB5

Pubmed 12730176

 

prodomImg

pubmed

1

233

S=789 I=71 E=3.35139e-87

HrpB5

Pubmed 1472717,8664494

 

prodomImg

pubmed

1

233

S=781 I=70 E=3.46743e-86

HrpB5

Pubmed 16957248

 

prodomImg

pubmed

1

233

S=767 I=68 E=1.6072e-84

HrpB5

Pubmed 11410350

 

prodomImg

pubmed

8

208

S=125 I=23 E=1.13924e-06

Putative type III secretion-associated protein SctL

Pubmed 10403415,11990489

 

prodomImg

Iprscan IPR018035 [PF02108]

116

213

Flagellar assembly protein FliH/Type III secretion system HrpE

Iprscan IPR012842 [TIGR02499]

34

207

Type III secretion system HrpE/YscL

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one le8qRQCI)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBi2yHNN/XFF4834R_chr04000.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBi2yHNN/XFF4834R_chr04000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBi2yHNN/XFF4834R_chr04000.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBi2yHNN/XFF4834R_chr04000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.