Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03990hrpB4XFF4834R_chr03990HrpB4 protein, type III secretion system

hrpB4 XFF4834R_chr03990
XFF4834R_chr03980
XFF4834R_chr03980
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04000
XFF4834R_chr04000
ID hrpB4
AC XFF4834R_chr03990
LT XFF4834R_chr03990
OR XFF4834R_chr from 449039 to 449668 on strand +
DE HrpB4 protein, type III secretion system
IP Type III secretion protein HrpB4
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110711)
MW 22310.5 Da
SQ 209 aa
 
........10........20........30........40........50
| | | | |
MDNTRIDNAARCVQRWTDALAHLAESLDAARVAHWLGPVAASGWAAAPVY
RRMRVIQAWSGWSGLSPSALGLPAHQLAVLMPPLLAKVLIARALFSRGLA
VRRCIERERLDWLEQCVGPAVLEHVRQNASAGLPVPLLPRDADQAAWVGD
GWRRMQADGVWPNPVVARLLALSLPLGAAQVATPAADGASDAFLTALPTL
MPEASCVSG
Show or not Domain decomposition
 
X.species

NP_640765.1 lcl|hrpB4-XAC0410

1

209

S=970 I=97 E=9.03375e-111

HrpB4 protein

X.species

YP_362161.1 lcl|hrpB4-XCV0430

1

209

S=970 I=94 E=9.35436e-111

HrpB4 protein

X.species

NP_636608.1 lcl|hrpB4-XCC1234

1

209

S=710 I=69 E=3.58305e-79

HrpB4 protein

pubmed

1

209

S=1045 I=100 E=3.21718e-118

HrpB4

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

209

S=970 I=97 E=3.54527e-109

HrpB4

Pubmed 12730176

 

prodomImg

pubmed

1

209

S=970 I=94 E=3.67109e-109

HrpB4

Pubmed 8664494,11844763

 

prodomImg

pubmed

1

209

S=961 I=93 E=5.15354e-108

HrpB4

Pubmed 16957248

 

prodomImg

pubmed

1

209

S=959 I=93 E=8.3975e-108

HrpB4

Pubmed 11410350

 

prodomImg

Iprscan IPR013393 [PF09502]

3

203

Type III secretion protein HrpB4

Iprscan IPR013393 [TIGR02560]

2

209

Type III secretion protein HrpB4

PD037291

1

209

S=433 I=57 E=5.56514e-45

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one vehG7IlJ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuZF57U/XFF4834R_chr03990.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuZF57U/XFF4834R_chr03990.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuZF57U/XFF4834R_chr03990.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuZF57U/XFF4834R_chr03990.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.