Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03980hrcJXFF4834R_chr03980type III secretion system apparatus protein HrcJ

hrcJ XFF4834R_chr03980
XFF4834R_chr03970
XFF4834R_chr03970
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03990
XFF4834R_chr03990
ID hrcJ
AC XFF4834R_chr03980
LT XFF4834R_chr03980
OR XFF4834R_chr from 448270 to 449031 on strand +
DE type III secretion system apparatus protein HrcJ
IP Type III secretion system lipoprotein HrcJ/YscJ; Secretory protein YscJ/FliF
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro
Biological Process: protein secretion (GO:0009306)

Curated
PM
AN
CC COG: [U] Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101118)
MW 27354 Da
SQ 253 aa
 
........10........20........30........40........50
| | | | |
MRALRYLVVLLVALLLSACSQQLYSGLTENDANDMLEVLLHAGVDASKVT
PDDGKTWAVNAPHDQVSYSLEVLRAHGLPHERHANLGEMFKKDGLISTPT
EERVRFIYGVSQQLSQTLSNIDGVISADVEIVLPNNDPLSTSVKPSSAAV
FIKFRVGSDLTSLVPNIKTLVMHSVEGLTYENVSVTLVPGGAESDAQFTA
SAPPRPSPWPWLAGCALALCLAVAAALYWWPNPQAGRWGGWQRLRELTKG
KAG
X.species

YP_362160.1 lcl|hrcJ-XCV0429

26

253

S=1018 I=87 E=2.06562e-116

HrcJ protein

X.species

NP_640764.1 lcl|hrcJ-XAC0409

26

253

S=1017 I=87 E=2.5464e-116

HrcJ protein

X.species

NP_636607.1 lcl|hrcJ-XCC1233

26

253

S=903 I=77 E=1.87115e-102

HrcJ protein

X.species

lcl|xsaJ-XALc_1486

26

185

S=171 I=29 E=8.42463e-14

probable xanthomonas secretion apparatus protein

pubmed

26

253

S=1021 I=88 E=3.23157e-115

HrcJ

Pubmed 15812033,18326683

 

prodomImg

pubmed

26

253

S=1020 I=87 E=4.58009e-115

HrcJ

Pubmed 12730176

 

prodomImg

pubmed

26

253

S=1018 I=87 E=7.52844e-115

Protein hrpB3 ; Cell membrane outer Hypersensitive response elicitation Lipoprotein Palmitate transport Signal Virulence

Pubmed 1472717

 

prodomImg

pubmed

26

253

S=993 I=85 E=8.26548e-112

HrcJ HrpB3

Pubmed 11410350

 

prodomImg

pubmed

26

253

S=983 I=84 E=1.43039e-110

HrpB3

Pubmed 16957248

 

prodomImg

pubmed

27

196

S=645 I=72 E=1.16106e-69

Hrp conserved lipoprotein hrcj transmembrane HrpI protein

Pubmed 1479894,1472716

 

prodomImg

pubmed

26

186

S=557 I=64 E=4.81078e-59

Lipoprotein transmembrane protein SctJ

Pubmed 10403415,11990489

 

prodomImg

pubmed

26

194

S=459 I=51 E=3.89739e-47

BcscJ

Pubmed 15183868

 

prodomImg

pubmed

26

194

S=426 I=51 E=3.88439e-43

BcscJ

Pubmed 11557147,12595458

 

prodomImg

pubmed

29

188

S=404 I=49 E=1.64876e-40

BscJ

Pubmed 9663681

 

prodomImg

sp

26

253

S=1018 I=87 E=5.19657e-115

Protein hrpB3 ; Cell membrane outer Hypersensitive response elicitation Lipoprotein Palmitate transport Signal Virulence

 

prodomImg

sp

27

197

S=405 I=47 E=1.09907e-40

Nodulation protein nolT ; Cell membrane outer Lipoprotein Palmitate Plasmid Signal Transmembrane

 

prodomImg

sp

27

197

S=387 I=46 E=1.40062e-38

Nodulation protein nolT ; Cell membrane outer Lipoprotein Palmitate Plasmid Signal Transmembrane

 

prodomImg

sp

26

190

S=306 I=41 E=1.03265e-28

Yop proteins translocation lipoprotein J ; Cell membrane outer Palmitate Plasmid transport Signal Transmembrane Virulence

 

prodomImg

sp

26

190

S=305 I=41 E=1.18724e-28

Yop proteins translocation lipoprotein J ; Cell membrane outer Palmitate Plasmid transport Signal Transmembrane Virulence

 

prodomImg

Iprscan IPR003282 [PR01338]

24

34

Type III secretion system lipoprotein HrcJ/YscJ

Iprscan IPR003282 [PR01338]

97

112

Type III secretion system lipoprotein HrcJ/YscJ

Iprscan IPR003282 [PR01338]

117

130

Type III secretion system lipoprotein HrcJ/YscJ

Iprscan IPR003282 [PR01338]

165

177

Type III secretion system lipoprotein HrcJ/YscJ

Iprscan IPR003282 [PR01338]

77

90

Type III secretion system lipoprotein HrcJ/YscJ

Iprscan IPR006182 [PF01514]

1

198

Secretory protein YscJ/FliF

Iprscan IPR003282 [TIGR02544]

3

195

Type III secretion system lipoprotein HrcJ/YscJ

Iprscan [PS51257]

1

19

-

PD002655

69

190

S=188 I=41 E=2.41742e-15

PD104938

188

253

S=176 I=56 E=7.76928e-14

PD511141

26

67

S=109 I=45 E=1.04715e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 6SCykCim)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

54 hits
swiss-prot

Swiss-Prot ncbi-blastp

11 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjCi4nM/XFF4834R_chr03980.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjCi4nM/XFF4834R_chr03980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjCi4nM/XFF4834R_chr03980.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjCi4nM/XFF4834R_chr03980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.