Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03970hrpB2XFF4834R_chr03970HrpB2 protein, type III secretion system

hrpB2 XFF4834R_chr03970
XFF4834R_chr03960
XFF4834R_chr03960
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03980
XFF4834R_chr03980
ID hrpB2
AC XFF4834R_chr03970
LT XFF4834R_chr03970
OR XFF4834R_chr from 447876 to 448268 on strand +
DE HrpB2 protein, type III secretion system
IP Type III secretion protein HrpB2
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110711)
MW 13752.9 Da
SQ 130 aa
 
........10........20........30........40........50
| | | | |
MTLIPPVQAIAGTSIASTQALSPVAAPNQALVNRFQALMQSASPLPPAMQ
RVGNPSMMSRVVDVQNDGVRTIAEHIDAFSMQAPTMGLQEMAAQQIKLMH
ELTMVGFNLNVSVGVAQSGKNAVQTLVKNQ
Show or not Domain decomposition
 
X.species

NP_640763.1 lcl|hrpB2-XAC0408

1

130

S=652 I=98 E=1.64948e-72

HrpB2 protein

X.species

YP_362159.1 lcl|hrpB2-XCV0428

1

130

S=642 I=97 E=2.59348e-71

HrpB2 protein

X.species

NP_636606.1 lcl|hrpB2-XCC1232

1

130

S=489 I=72 E=9.86876e-53

HrpB2 protein

pubmed

1

130

S=658 I=100 E=8.83006e-72

HrpB2

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

130

S=652 I=98 E=5.32088e-71

HrpB2

Pubmed 12730176

 

prodomImg

pubmed

1

130

S=642 I=97 E=7.27671e-70

HrpB2

Pubmed 11410350,10714988

 

prodomImg

pubmed

1

130

S=639 I=96 E=1.78626e-69

HrpB2

Pubmed 8664494,11844763

 

prodomImg

pubmed

1

130

S=580 I=95 E=2.65207e-62

HrpB2

Pubmed 16957248

 

prodomImg

Iprscan IPR013391 [PF09487]

16

130

Type III secretion protein HrpB2

Iprscan IPR013391 [TIGR02558]

9

130

Type III secretion protein HrpB2

PD032000

29

130

S=456 I=83 E=7.83464e-48

PDA1O425

1

30

S=125 I=90 E=1.12177e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ehutlYCG)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBY_U6y0/XFF4834R_chr03970.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBY_U6y0/XFF4834R_chr03970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBY_U6y0/XFF4834R_chr03970.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBY_U6y0/XFF4834R_chr03970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.