Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03960hrpB1XFF4834R_chr03960HrpB1 protein, type III secretion system

hrpB1 XFF4834R_chr03960
XFF4834R_chr03950
XFF4834R_chr03950
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03970
XFF4834R_chr03970
ID hrpB1
AC XFF4834R_chr03960
LT XFF4834R_chr03960
OR XFF4834R_chr from 447387 to 447842 on strand +
DE HrpB1 protein, type III secretion system
IP Type III secretion system, HrpB1/HrpK
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110711)
MW 16030.2 Da
SQ 151 aa
 
........10........20........30........40........50
| | | | |
MEKIQCPGSVVSGLIELITVGLTHEKIQDAAAVLAAVRILRPELKALDTF
DAWISIKRGNYVEGARLLRELEGDAGSKPLCRALYACCLFAMGDPSWHGV
ADGLVEEDADADAVALVKALSGRSTPTSAPPEVPVESSAPMEVPNSQYLR
A
Show or not Domain decomposition
 
X.species

YP_362158.1 lcl|hrpB1-XCV0427

1

151

S=581 I=76 E=7.63899e-64

HrpB1 protein

X.species

NP_640762.1 lcl|hrpB1-XAC0407

1

151

S=574 I=75 E=5.9274e-63

HrpB1 protein

X.species

NP_636605.1 lcl|hrpB1-XCC1231

1

151

S=475 I=65 E=5.33164e-51

HrpB1 protein

pubmed

1

151

S=604 I=78 E=4.39777e-65

HrpB1

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

151

S=583 I=75 E=1.86667e-62

HrpB1

Pubmed 11410350

 

prodomImg

pubmed

1

151

S=581 I=76 E=2.66879e-62

HrpB1

Pubmed 8664494,11844763

 

prodomImg

pubmed

1

151

S=576 I=74 E=1.2273e-61

HrpB1

Pubmed 16957248

 

prodomImg

pubmed

1

151

S=574 I=75 E=2.07082e-61

HrpB1

Pubmed 12730176

 

prodomImg

Iprscan IPR013394 [PF09613]

2

146

Type III secretion system, HrpB1/HrpK

Iprscan IPR013394 [TIGR02561]

2

151

Type III secretion system, HrpB1/HrpK

PD033924

1

98

S=253 I=49 E=3.89532e-23

PDA1T2Q6

121

151

S=139 I=90 E=2.36277e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one pfkEIGuq)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBLbKycu/XFF4834R_chr03960.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBLbKycu/XFF4834R_chr03960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBLbKycu/XFF4834R_chr03960.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBLbKycu/XFF4834R_chr03960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.