Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03950hrcUXFF4834R_chr03950type III secretion system protein HrcU

hrcU XFF4834R_chr03950
XFF4834R_chr03940
XFF4834R_chr03940
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03960
XFF4834R_chr03960
ID hrcU
AC XFF4834R_chr03950
LT XFF4834R_chr03950
OR XFF4834R_chr from 446097 to 447170 on strand -
DE type III secretion system protein HrcU
IP Type III secretion exporter
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro
Biological Process: protein secretion (GO:0009306)
Biological Process: transport (GO:0006810)
Cellular Component: integral to membrane (GO:0016021)
Cellular Component: membrane (GO:0016020)

Curated
PM
AN
CC COG: [NU] Cell motility;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100512)
MW 38835.1 Da
SQ 357 aa
 
........10........20........30........40........50
| | | | |
MSEEKTEKPTEKKLRDARRDGEVPVSPDVTAAAVLFGALLVMKSAGDYFA
DHMRALMTIGFDFPENTRDAAAINRALGHIGIQGLLLMLPFLVGCLVAGV
AGGAFQTGLNASLKPVAPKFDSLNPATGVKKLFSLRSLINLLKLIIKAIL
IGVVLWAGIRILMPMIIGLAYQTPPDIAQIAWRTLGMLFALGVLLFVLVG
AADWSVQHWLFIRDKRMSKDEQKREVKESEGDPEIKGKRKEFAKEMVFGD
PRERVAKAKVMVVNPTHYAVALAYEPDDFGLPQVVAKGVDDGALELRAFA
HNQGIPIVANPPLARALYQVELGDAVPEPLFETVAVVLRWVDELGRDHGD
GDGALPC
XFF4834R

XFF4834R_chr20670 lcl|flhB-XFF4834R_chr20670

14

344

S=323 I=30 E=1.52065e-32

predicted flagellar export pore protein

XFF4834R

XFF4834R_chr20670 lcl|flhB-XFF4834R_chr20670

14

344

S=323 I=30 E=1.52065e-32

predicted flagellar export pore protein

X.species

NP_640761.1 lcl|hrcU-XAC0406

1

357

S=1461 I=80 E=6.84525e-170

type III secretion system protein HrcU

X.species

YP_362157.1 lcl|hrcU-XCV0426

14

357

S=1430 I=81 E=3.4864e-166

type III secretion system protein HrcU

X.species

NP_636604.1 lcl|hrcU-XCC1230

14

357

S=1221 I=72 E=7.04029e-141

type III secretion system protein HrcU

X.species

NP_642263.1 lcl|flhB-XAC1937

14

344

S=322 I=30 E=5.99469e-32

flagellar biosynthesis protein FlhB

X.species

YP_363712.1 lcl|flhB-XCV1981

14

344

S=320 I=30 E=1.20417e-31

flagellar biosynthesis protein FlhB

X.species

lcl|flhB-XALc_1383

14

344

S=307 I=28 E=4.07789e-30

probable flagellar biosynthesis pathway component flhb protein

X.species

NP_637275.1 lcl|flhB-XCC1910

203

344

S=295 I=44 E=1.13004e-28

flagellar biosynthesis protein FlhB

X.species

NP_637275.1 lcl|flhB-XCC1910

14

130

S=104 I=26 E=1.98814e-05

flagellar biosynthesis protein FlhB

X.species

lcl|xsaZ-XALc_1502

203

356

S=192 I=28 E=3.5986e-16

probable xanthomonas secretion apparatus protein

pubmed

1

357

S=1488 I=82 E=1.46648e-171

HrcU

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

357

S=1433 I=81 E=6.71026e-165

HrcU

Pubmed 12730176

 

prodomImg

pubmed

1

357

S=1429 I=81 E=2.10267e-164

HrcU homolog

Pubmed 10478481

 

prodomImg

pubmed

1

357

S=1388 I=76 E=1.82127e-159

HrcU

Pubmed 16957248

 

prodomImg

pubmed

1

357

S=1385 I=76 E=3.75538e-159

HrcU

Pubmed 11410350

 

prodomImg

pubmed

14

345

S=635 I=44 E=2.87308e-68

Hypersensitivity response secretion protein hrcU ; Cell membrane Hypersensitive elicitation Plasmid transport Transmembrane

Pubmed 8316211

 

prodomImg

pubmed

14

345

S=565 I=38 E=8.7883e-60

SctU

Pubmed 10403415,11990489

 

prodomImg

pubmed

14

343

S=391 I=30 E=1.23463e-38

LscU

Pubmed 12564983

 

prodomImg

pubmed

14

349

S=373 I=28 E=1.55972e-36

AscU protein ; Plasmid

Pubmed 14594831

 

prodomImg

pubmed

14

349

S=371 I=28 E=2.87145e-36

AscU

Pubmed 17517651

 

prodomImg

sp

14

345

S=635 I=44 E=1.97744e-68

Hypersensitivity response secretion protein hrcU ; Cell membrane Hypersensitive elicitation Plasmid transport Transmembrane

 

prodomImg

sp

15

341

S=339 I=28 E=1.55658e-32

Flagellar biosynthetic protein flhB ; Bacterial flagellum biogenesis export Cell membrane transport Transmembrane

 

prodomImg

sp

14

350

S=329 I=26 E=2.74114e-31

Yop proteins translocation protein U ; Cell membrane Plasmid transport Transmembrane Virulence

 

prodomImg

sp

14

350

S=329 I=26 E=2.74114e-31

Yop proteins translocation protein U ; Cell membrane Plasmid transport Transmembrane Virulence

 

prodomImg

sp

14

346

S=326 I=28 E=6.06043e-31

Flagellar biosynthetic protein flhB ; Bacterial flagellum biogenesis export Cell inner membrane transport Transmembrane

 

prodomImg

Iprscan IPR006135 [PR00950]

6

28

Type III secretion exporter

Iprscan IPR006135 [PR00950]

203

221

Type III secretion exporter

Iprscan IPR006135 [PR00950]

223

240

Type III secretion exporter

Iprscan IPR006135 [PR00950]

267

282

Type III secretion exporter

Iprscan IPR006135 [PR00950]

297

318

Type III secretion exporter

Iprscan IPR006135 [PF01312]

1

341

Type III secretion exporter

Iprscan IPR006307 [TIGR01404]

3

344

Type III secretion protein HrpY/HrcU

PD775898

263

341

S=236 I=59 E=3.69153e-21

PDA8D4V9

238

262

S=118 I=96 E=8.64955e-07

PDA8D4R7

239

262

S=113 I=96 E=3.03564e-06

PDA8D4R8

239

262

S=110 I=92 E=7.19638e-06

PD002940

203

238

S=104 I=53 E=3.70661e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Ue8Z15WN)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

70 hits
swiss-prot

Swiss-Prot ncbi-blastp

29 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzayCwY/XFF4834R_chr03950.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzayCwY/XFF4834R_chr03950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzayCwY/XFF4834R_chr03950.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzayCwY/XFF4834R_chr03950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.