Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03940hrcVXFF4834R_chr03940Type III secretion system apparatus protein HrcV

hrcV XFF4834R_chr03940
XFF4834R_chr03930
XFF4834R_chr03930
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03950
XFF4834R_chr03950
ID hrcV
AC XFF4834R_chr03940
LT XFF4834R_chr03940
OR XFF4834R_chr from 444166 to 446103 on strand -
DE Type III secretion system apparatus protein HrcV
IP Type III secretion system FHIPEP; Type III secretion protein HrcV
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro
Biological Process: protein secretion (GO:0009306)
Biological Process: protein transport (GO:0015031)
Cellular Component: membrane (GO:0016020)
Cellular Component: integral to membrane (GO:0016021)

Curated
PM
AN
CC COG: [U] Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101118)
MW 69922 Da
SQ 645 aa
 
........10........20........30........40........50
| | | | |
MLGDRVRATRYFAYSGEVAIAALVVAVIGLMILPLPTPLIDTLLGINITL
SVVLLMVTMYVPDSISLSSFPSLLLFTTLLRLSLNIASTKSILLHAEAGH
IIESFGELVVGGNLVVGLVVFLIITTVQFIVIAKGSERVAEVGARFTLDA
MPGKQMSIDADLRGGNLTADEARRKRARLAMESQLHGGMDGAMKFVKGDA
IAGLVITMVNILAGIVVGVTYHGMTAGEAANRFAILSVGDAMVSQIASLL
ISVAAGVMITRVANENETRLSSLGLDIGRQLTSNARALMAASVLLACFAF
VPGFPAVLFLLLAAAVGAGGYTIWRKQRDISGTDQRKLPSTSRKGAKGEA
PHIRKNAPDFASPLSMRLSPQLANLLDPARLDQAIESERRQLVELLGLPF
PGIAIWQSESLQDMQYEVLIHDVPETRAELGDTDDMQAALARQAIAPLHA
RAHLFVGIQETQWMLEQVAVDYPGLVAEVNKAMPAQRIADVLRRLLEERI
PVRNIKSILESLVVWGPKEKDLLMLTEYVRCDLSRYIAHTATAGTGQLPA
VMLDHAVEQLIRQSIRATAAGNFLALPPEQANQLVEQVERIVGDQAQHPL
AVVASMDVRRYVRRMIEARLTWLQVYSFQELGSEVQLQPIGRVVV
XFF4834R

XFF4834R_chr20660 lcl|flhA-XFF4834R_chr20660

47

430

S=436 I=29 E=5.39252e-46

predicted flagellar export pore protein

XFF4834R

XFF4834R_chr20660 lcl|flhA-XFF4834R_chr20660

455

643

S=205 I=30 E=4.9994e-18

predicted flagellar export pore protein

X.species

NP_640760.1 lcl|hrcV-XAC0405

1

645

S=2810 I=86 E=0

HrcV protein

X.species

YP_362156.1 lcl|hrcV-XCV0425

6

645

S=2733 I=84 E=0

HrcV protein

X.species

NP_636603.1 lcl|hrcV-XCC1229

6

644

S=2619 I=81 E=0

HrcV

X.species

lcl|xsaQ-XALc_1493

47

331

S=496 I=39 E=1.17742e-52

probable xanthomonas secretion apparatus protein

X.species

lcl|xsaQ-XALc_1493

455

643

S=407 I=43 E=6.6194e-42

probable xanthomonas secretion apparatus protein

X.species

lcl|flhA-XALc_1382

47

430

S=459 I=30 E=3.87464e-48

probable flagellar biosynthesis pathway component , flha protein

X.species

lcl|flhA-XALc_1382

455

643

S=191 I=30 E=9.50595e-16

probable flagellar biosynthesis pathway component , flha protein

X.species

NP_642262.1 lcl|flhA-XAC1936

47

430

S=445 I=30 E=1.81167e-46

flagellar biosynthesis protein FlhA

X.species

NP_642262.1 lcl|flhA-XAC1936

455

643

S=204 I=30 E=2.83161e-17

flagellar biosynthesis protein FlhA

X.species

YP_363711.1 lcl|flhA-XCV1980

47

430

S=442 I=29 E=4.33242e-46

flagellar biosynthesis protein FlhA

pubmed

1

645

S=2819 I=86 E=0

HrcV

Pubmed 15812033,18326683

 

prodomImg

pubmed

6

645

S=2780 I=86 E=0

HrcV

Pubmed 12730176

 

prodomImg

pubmed

1

645

S=2764 I=85 E=0

Protein hrpC2 ; Cell inner membrane Hypersensitive response elicitation transport Transmembrane

Pubmed 1472717

 

prodomImg

pubmed

6

645

S=2760 I=85 E=0

HrcV homolog

Pubmed 10478481

 

prodomImg

pubmed

1

645

S=2726 I=84 E=0

HrcV HrcV protein HrpC2

Pubmed 11410350

 

prodomImg

pubmed

1

645

S=2722 I=84 E=0

HrcV

Pubmed 16957248

 

prodomImg

pubmed

47

445

S=1095 I=57 E=1.02411e-123

Hypersensitivity response secretion protein hrcV ; Cell inner membrane Hypersensitive elicitation Plasmid transport Transmembrane

Pubmed 8316211

 

prodomImg

pubmed

440

645

S=676 I=62 E=7.7556e-73

Hypersensitivity response secretion protein hrcV ; Cell inner membrane Hypersensitive elicitation Plasmid transport Transmembrane

Pubmed 8316211

 

prodomImg

pubmed

47

430

S=1009 I=56 E=2.96798e-113

SctV

Pubmed 10403415,11990489

 

prodomImg

pubmed

440

643

S=651 I=59 E=6.67047e-70

SctV

Pubmed 10403415,11990489

 

prodomImg

Iprscan IPR001712 [PR00949]

182

199

Type III secretion system FHIPEP

Iprscan IPR001712 [PR00949]

233

247

Type III secretion system FHIPEP

Iprscan IPR001712 [PR00949]

152

170

Type III secretion system FHIPEP

Iprscan IPR001712 [PR00949]

34

47

Type III secretion system FHIPEP

Iprscan IPR001712 [PR00949]

71

90

Type III secretion system FHIPEP

Iprscan IPR001712 [PR00949]

133

149

Type III secretion system FHIPEP

Iprscan IPR001712 [PF00771]

26

637

Type III secretion system FHIPEP

Iprscan IPR006302 [TIGR01399]

14

643

Type III secretion protein HrcV

Iprscan IPR001712 [PS00994]

138

161

Type III secretion system FHIPEP

PD001265

85

249

S=366 I=51 E=1.02759e-36

PD567472

321

435

S=349 I=60 E=1.09999e-34

PD586113

527

643

S=205 I=40 E=2.82968e-17

PD859090

436

469

S=137 I=76 E=4.8684e-09

PDA1F773

472

526

S=135 I=50 E=9.20028e-09

PDA9A5G2

451

521

S=106 I=35 E=2.85075e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gajAMFP3)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

192 hits
swiss-prot

Swiss-Prot ncbi-blastp

58 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4Q2TJN/XFF4834R_chr03940.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4Q2TJN/XFF4834R_chr03940.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4Q2TJN/XFF4834R_chr03940.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4Q2TJN/XFF4834R_chr03940.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.