Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03930hpaPXFF4834R_chr03930HpaP protein, type III secretion system

hpaP XFF4834R_chr03930
XFF4834R_chr03920
XFF4834R_chr03920
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03940
XFF4834R_chr03940
ID hpaP
AC XFF4834R_chr03930
LT XFF4834R_chr03930
OR XFF4834R_chr from 443528 to 444166 on strand -
DE HpaP protein, type III secretion system
IP Type III secretion protein HpaP
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: validated by jacques (20110711)
MW 23557.3 Da
SQ 212 aa
 
........10........20........30........40........50
| | | | |
MRKPPLRHVRILPVSGALQRPAAPATPARSAQRSSFLQLRQRLRNAQLAL
PCMVLPPQCDEDRPEPDAEESFTEAHDSAPVQTDPPLRSDGPKHQEPSQG
NDNGAVGRQIATEWIRTQRAQMAIDHIALRVAEFCNATSVRNAGSWEAWL
DIDQEVVAQTTLFLRLSPDQLSLRFNTSSPDAREVLWCGRQRLEAALKST
LSSTLQISIEVV
Show or not Domain decomposition
 
X.species

YP_362155.1 lcl|hpaC-XCV0424

1

212

S=832 I=77 E=5.63625e-94

HpaC protein

X.species

NP_640759.1 lcl|hpaP-XAC0404

9

212

S=757 I=74 E=6.10367e-85

HpaP protein

X.species

NP_636602.1 lcl|hpaP-XCC1228

51

212

S=486 I=60 E=5.25547e-52

HpaP protein

pubmed

9

212

S=859 I=83 E=1.20329e-95

HpaP

Pubmed 15812033,18326683

 

prodomImg

pubmed

9

212

S=784 I=77 E=1.55132e-86

HpaP HrpC3

Pubmed 11410350

 

prodomImg

pubmed

9

212

S=768 I=76 E=1.2346e-84

HpaP

Pubmed 16957248

 

prodomImg

pubmed

9

212

S=756 I=74 E=3.33293e-83

HpaP homolog

Pubmed 10478481

 

prodomImg

pubmed

9

212

S=756 I=74 E=3.33293e-83

HpaP

Pubmed 12730176

 

prodomImg

sp

70

207

S=155 I=31 E=1.43658e-10

HRP-associated protein ; Plasmid

 

prodomImg

Iprscan IPR013390 [PF09483]

23

211

Type III secretion protein HpaP

Iprscan IPR013390 [TIGR02557]

13

212

Type III secretion protein HpaP

Iprscan [seg]

17

50

-

PD102579

91

210

S=256 I=51 E=1.44612e-23

PDA3B523

54

122

S=127 I=43 E=6.74159e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one xS1lYK6Z)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp8lG6u/XFF4834R_chr03930.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp8lG6u/XFF4834R_chr03930.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp8lG6u/XFF4834R_chr03930.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBp8lG6u/XFF4834R_chr03930.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.