Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03920hrcQXFF4834R_chr03920type III secretion system protein HrcQ

hrcQ XFF4834R_chr03920
XFF4834R_chr03910
XFF4834R_chr03910
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03930
XFF4834R_chr03930
ID hrcQ
AC XFF4834R_chr03920
LT XFF4834R_chr03920
OR XFF4834R_chr from 442482 to 443396 on strand -
DE type III secretion system protein HrcQ
IP Type III secretion system apparatus protein YscQ/HrcQ
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro
Biological Process: protein secretion by the type III secretion system (GO:0030254)

Curated
PM
AN Start modifie car N-ter trop long compare aux orthologues chez XCV XCC et XAC (confirme par BlastP - Darsonval et al. 2008). 30aa deletes.
CC COG: [NU] Cell motility;Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100512)
MW 31767.1 Da
SQ 304 aa
 
........10........20........30........40........50
| | | | |
VLGDPRAARHCGFATHCRRISPNDAARLRLQLDTGQMDVRIAARDGLALL
LNEDDHALRVSIAGMLLADRLGALAPLGVGTAEVIAFERDAEPDDCHGIG
MTLGDLDAIPLTASAPLLATLRTAVAALAAPAPLPAWLAALRVNTRLRIG
ERTASAALLQSLRPGDVLLHCAGPAAATSGQVLWGIAGGAVLRAPVRLNL
QQMILEATPTMQHDTFEPDVAQSASNVAELELPVQLEVDQLALSLSTLSG
LQPGQILELSVPVDQADIRLVVYGQTIGIGRLVTVGEHLGVQILSMSEGT
HADA
X.species

NP_640758.1 lcl|hrcQ-XAC0403

1

304

S=1266 I=84 E=2.13703e-146

HrcQ protein

X.species

YP_362154.1 lcl|hrcQ-XCV0423

1

304

S=1209 I=80 E=1.84794e-139

HrcQ protein

X.species

NP_636601.1 lcl|hrcQ-XCC1227

1

304

S=907 I=65 E=6.46024e-103

HrcQ protein

pubmed

1

304

S=1337 I=89 E=2.13799e-153

HrcQ

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

304

S=1251 I=83 E=5.20463e-143

HrcQ homolog

Pubmed 10478481

 

prodomImg

pubmed

1

304

S=1251 I=83 E=5.20463e-143

HrcQ

Pubmed 12730176

 

prodomImg

pubmed

1

304

S=1187 I=79 E=3.20059e-135

HrcQ

Pubmed 16957248

 

prodomImg

pubmed

1

304

S=1175 I=78 E=9.59329e-134

HrcQ

Pubmed 11410350

 

prodomImg

pubmed

37

304

S=1031 I=79 E=2.36257e-116

HrcQ

Pubmed 9781876,11844763

 

prodomImg

pubmed

37

109

S=308 I=86 E=1.02812e-28

Pathogenicity protein

Pubmed 1312532

 

prodomImg

pubmed

184

297

S=223 I=39 E=1.91005e-18

SctQ

Pubmed 10403415,11990489

 

prodomImg

pubmed

146

298

S=173 I=35 E=2.71716e-12

Hrp conserved protein hrcq HrpQ protein

Pubmed 1479894,1472716

 

prodomImg

pubmed

198

298

S=134 I=31 E=1.32376e-07

BcscQ

Pubmed 11557147

 

prodomImg

sp

161

300

S=131 I=34 E=2.21909e-07

Yop proteins translocation protein Q ; Plasmid transport Virulence

 

prodomImg

sp

161

300

S=131 I=34 E=2.21909e-07

Yop proteins translocation protein Q ; Plasmid transport Virulence

 

prodomImg

Iprscan IPR001543 [PF01052]

225

297

Surface presentation of antigen (SpoA)

Iprscan IPR013385 [TIGR02551]

33

296

Type III secretion system apparatus protein YscQ/HrcQ

Iprscan [seg]

111

143

-

PD329152

37

109

S=343 I=95 E=4.64348e-34

PD565189

145

218

S=300 I=81 E=6.55375e-29

PD334023

1

36

S=181 I=92 E=2.06546e-14

Iprscan IPR001543 [SSF101801]

221

301

Surface presentation of antigen (SpoA)

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one uFhJptEt)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdcW9hY/XFF4834R_chr03920.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdcW9hY/XFF4834R_chr03920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdcW9hY/XFF4834R_chr03920.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdcW9hY/XFF4834R_chr03920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.