Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03910hrcRXFF4834R_chr03910type III secretion system apparatus protein

hrcR XFF4834R_chr03910
XFF4834R_chr03900
XFF4834R_chr03900
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03920
XFF4834R_chr03920
ID hrcR
AC XFF4834R_chr03910
LT XFF4834R_chr03910
OR XFF4834R_chr from 441851 to 442495 on strand -
DE type III secretion system apparatus protein
IP Yop virulence translocation protein R
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro
Biological Process: protein secretion (GO:0009306)
Biological Process: protein transport (GO:0015031)
Cellular Component: integral to membrane (GO:0016021)
Cellular Component: membrane (GO:0016020)

Curated
PM
AN
CC COG: [U] Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101118)
MW 23566.1 Da
SQ 214 aa
 
........10........20........30........40........50
| | | | |
MQMPDVGSLLLVVIMLGLLPFAAMVVTSYTKIVVVLGLLRNAIGVQQVPP
NMVLNGVALLVSCFVMAPVGMEAFKAAQNYGTGSDNSRVVVLLDACREPF
RQFLLKHTREREKVFFMRSAQQIWPKDKAATLKSDDLLVLAPAFTLSELT
EAFRIGFLLYLVFIVIDLVVANALMAMGLSQVTPTNVAIPFKLLLFVAMD
GWSMLMHGLVLSYR
XFF4834R

XFF4834R_chr20730 lcl|fliP-XFF4834R_chr20730

20

214

S=263 I=38 E=1.32148e-25

flagellar biosynthesis protein

X.species

YP_362153.1 lcl|hrcR-XCV0422

1

214

S=1021 I=92 E=6.70139e-117

type III secretion system protein

X.species

NP_640757.1 lcl|hrcR-XAC0402

1

214

S=1021 I=92 E=6.70139e-117

type III secretion system protein

X.species

NP_636600.1 lcl|hrcR-XCC1226

1

214

S=987 I=89 E=8.23361e-113

type III secretion system protein

X.species

lcl|xsaW-XALc_1499

20

213

S=365 I=41 E=2.2799e-37

probable xanthomonas secretion apparatus protein

X.species

lcl|fliP-XALc_1386

20

214

S=274 I=38 E=2.46486e-26

probable flagellar biosynthetic protein flip

X.species

NP_637281.1 lcl|fliP-XCC1916

20

214

S=264 I=38 E=4.08363e-25

flagellar biosynthesis protein FliP

X.species

NP_642270.1 lcl|fliP-XAC1944

20

214

S=263 I=38 E=4.41697e-25

flagellar biosynthesis protein FliP

X.species

YP_363719.1 lcl|fliP-XCV1988

20

214

S=263 I=38 E=4.73606e-25

flagellar biosynthesis protein FliP

pubmed

1

214

S=1035 I=93 E=5.631e-117

HrcR ; Transmembrane

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

214

S=1021 I=92 E=2.39212e-115

HrcR ; Transmembrane

Pubmed 9781876,11844763

 

prodomImg

pubmed

1

214

S=1011 I=90 E=4.32417e-114

HrcR ; Transmembrane

Pubmed 16957248

 

prodomImg

pubmed

20

214

S=1002 I=98 E=4.63268e-113

HrcR ; Transmembrane

Pubmed 12730176

 

prodomImg

pubmed

1

214

S=1001 I=91 E=6.45237e-113

Pathogenicity-related ORF2 ; Cell membrane Transmembrane Virulence

Pubmed 1312532

 

prodomImg

pubmed

20

214

S=992 I=98 E=7.28396e-112

HrcR homolog ; Transmembrane

Pubmed 10478481

 

prodomImg

pubmed

20

214

S=987 I=96 E=3.12402e-111

HrcR ; Transmembrane

Pubmed 11410350

 

prodomImg

pubmed

20

214

S=793 I=77 E=9.77187e-88

Hypersensitivity response secretion protein hrcR ; Cell membrane Hypersensitive elicitation Plasmid Transmembrane

Pubmed 7623665

 

prodomImg

pubmed

20

214

S=733 I=69 E=1.81998e-80

Putative type III secretion-associated protein SctR ; Transmembrane

Pubmed 10403415,11990489

 

prodomImg

pubmed

20

214

S=653 I=59 E=1.10763e-70

BcscR ; Transmembrane

Pubmed 11557147

 

prodomImg

sp

1

214

S=1001 I=91 E=4.46195e-113

Pathogenicity-related ORF2 ; Cell membrane Transmembrane Virulence

 

prodomImg

sp

20

214

S=793 I=77 E=6.75746e-88

Hypersensitivity response secretion protein hrcR ; Cell membrane Hypersensitive elicitation Plasmid Transmembrane

 

prodomImg

Iprscan IPR005838 [PR01302]

10

29

Type III secretion system inner membrane P protein

Iprscan IPR005838 [PR01302]

29

49

Type III secretion system inner membrane P protein

Iprscan IPR005838 [PR01302]

49

68

Type III secretion system inner membrane P protein

Iprscan IPR005838 [PR01302]

142

162

Type III secretion system inner membrane P protein

Iprscan IPR005838 [PR01302]

163

184

Type III secretion system inner membrane P protein

Iprscan IPR005838 [PR01302]

187

212

Type III secretion system inner membrane P protein

Iprscan IPR005838 [PF00813]

12

210

Type III secretion system inner membrane P protein

Iprscan IPR005773 [TIGR01102]

9

209

Yop virulence translocation protein R

Iprscan IPR005838 [PS01061]

190

202

Type III secretion system inner membrane P protein

Iprscan IPR005838 [PS01060]

142

157

Type III secretion system inner membrane P protein

PD002586

59

214

S=416 I=54 E=6.3481e-43

PDA1M973

59

98

S=200 I=95 E=7.65756e-17

PD546543

28

58

S=109 I=68 E=8.49817e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one efLzTVP0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

134 hits
swiss-prot

Swiss-Prot ncbi-blastp

30 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AXR8P/XFF4834R_chr03910.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AXR8P/XFF4834R_chr03910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AXR8P/XFF4834R_chr03910.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AXR8P/XFF4834R_chr03910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.