Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03900hrcSXFF4834R_chr03900type III secretion system apparatus protein HrcS

hrcS XFF4834R_chr03900
XFF4834R_chr03890
XFF4834R_chr03890
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03910
XFF4834R_chr03910
ID hrcS
AC XFF4834R_chr03900
LT XFF4834R_chr03900
OR XFF4834R_chr from 441586 to 441846 on strand -
DE type III secretion system apparatus protein HrcS
IP Bacterial export protein FliQ, family 3; Type III secretion protein HrpO
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro
Biological Process: protein secretion (GO:0009306)
Biological Process: transport (GO:0006810)
Cellular Component: integral to membrane (GO:0016021)
Cellular Component: membrane (GO:0016020)

Curated
PM
AN
CC COG: [U] Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101118)
MW 8913.6 Da
SQ 86 aa
 
........10........20........30........40........50
| | | | |
MDHDDLVRFTSEALLLCLKVSLPVVGVAALAGLLIAFVQAVMSLQDASIS
FALKLVVVVAAIAVTAPWGASAIMQFGQALMQAAFP
X.species

YP_362152.1 lcl|hrcS-XCV0421

1

86

S=280 I=70 E=6.72692e-28

HrcS protein

X.species

NP_640756.1 lcl|hrcS-XAC0401

1

86

S=279 I=69 E=9.8724e-28

HrcS protein

X.species

NP_636599.1 lcl|hrcS-XCC1225

7

86

S=239 I=65 E=5.82665e-23

HrcS protein

pubmed

1

86

S=282 I=70 E=2.02418e-26

HrcS

Pubmed 16957248

 

prodomImg

pubmed

1

86

S=281 I=70 E=2.5392e-26

HrcS HrcS protein HrpD3

Pubmed 11410350

 

prodomImg

pubmed

1

86

S=280 I=70 E=3.0494e-26

HrcS

Pubmed 9781876,11844763

 

prodomImg

pubmed

1

86

S=280 I=70 E=3.0494e-26

HrcS

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

86

S=279 I=69 E=4.47528e-26

HrcS

Pubmed 12730176

 

prodomImg

pubmed

1

86

S=279 I=69 E=4.47528e-26

HrcS homolog

Pubmed 10478481

 

prodomImg

pubmed

1

86

S=148 I=36 E=3.08866e-10

Putative type III secretory pathway and flagellar biosynthesis protein SctS ; Flagellum

Pubmed 10403415,11990489

 

prodomImg

pubmed

1

85

S=145 I=45 E=7.71532e-10

Hrp conserved hrcs transmembrane protein Hrp conserved protein hrcs Hrp conserved transmembrane protein HrpU protein

Pubmed 1479894,1472716

 

prodomImg

Iprscan IPR002191 [PF01313]

4

79

Bacterial export protein FliQ, family 3

Iprscan IPR006306 [TIGR01403]

5

85

Type III secretion protein HrpO

Iprscan [seg]

24

34

-

Iprscan [seg]

52

66

-

Iprscan [tmhmm]

20

42

-

Iprscan [tmhmm]

55

77

-

PD334222

67

86

S=102 I=100 E=7.3237e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one zJrBM4GQ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

8 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeGD5Wc/XFF4834R_chr03900.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeGD5Wc/XFF4834R_chr03900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeGD5Wc/XFF4834R_chr03900.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeGD5Wc/XFF4834R_chr03900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.