Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03880hrcDXFF4834R_chr03880HrcD protein, type III secretion system

hrcD XFF4834R_chr03880
XFF4834R_chr03870
XFF4834R_chr03870
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03890
XFF4834R_chr03890
ID hrcD
AC XFF4834R_chr03880
LT XFF4834R_chr03880
OR XFF4834R_chr from 439827 to 440765 on strand -
DE HrcD protein, type III secretion system
IP
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro


Curated
PM
AN erreur de manip conservation de l'anotation de Ralf
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: validated by jacques (20110711)
MW 33449.4 Da
SQ 312 aa
 
........10........20........30........40........50
| | | | |
MTMQLRVLTGTHAGARLDLAQGRYTLGSDPQTDIRIDDWPGCSLILEVDH
DGQIRYSSDTLPETSFVAFQPVRFGPLVLCVGEAAADWPDDVALLERLLS
PAPTPAPPASRRKVLRTAVGAMLALSAAALIPSLQPAFLSDAAPPQRPEN
AVNQANALLKQLGFREAHAQRVGTRVLIEGLVPSSADAARLRAQVHRYHP
GVAVNVAVVDEVVATLRDTLADPALSVRYQGDGIFSVSGSSDYAERASRR
IADVRSDLGPEVRALHVEISQQDPSIKPPDNYDAALLADGLHYVETPDGT
KHMTSLPQQAAQ
Show or not Domain decomposition
 
X.species

YP_362150.1 lcl|hrcD-XCV0419

1

312

S=1272 I=80 E=4.68658e-147

HrcD protein

X.species

NP_640754.1 lcl|hrpD5-XAC0399

1

312

S=1269 I=79 E=1.01825e-146

HrpD5 protein

X.species

NP_636597.1 lcl|hrpD5-XCC1223

1

311

S=1003 I=64 E=1.54654e-114

HrpD5 protein

pubmed

1

312

S=1363 I=87 E=1.75893e-156

HrpD5

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

312

S=1272 I=80 E=1.77351e-145

HrpD5

Pubmed 9781876,11844763

 

prodomImg

pubmed

1

312

S=1270 I=79 E=2.99242e-145

HrpD5

Pubmed 12730176

 

prodomImg

pubmed

1

312

S=1236 I=79 E=4.04669e-141

HrpD5

Pubmed 11410350

 

prodomImg

pubmed

1

312

S=1234 I=79 E=6.36793e-141

HrpD5

Pubmed 16957248

 

prodomImg

pubmed

5

303

S=279 I=31 E=3.3082e-25

SctD Transmembrane protein

Pubmed 10403415,11990489

 

prodomImg

pubmed

1

99

S=190 I=42 E=2.02929e-14

HrpW protein Hrpw transmembrane protein

Pubmed 1479894,1472716

 

prodomImg

pubmed

143

301

S=146 I=28 E=4.02406e-09

HrpW protein Hrpw transmembrane protein

Pubmed 1479894,1472716

 

prodomImg

PD132206

153

312

S=398 I=52 E=8.90589e-41

PD132206

1

100

S=271 I=54 E=2.27492e-25

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one NcpWETsU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

8 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAqpLvD/XFF4834R_chr03880.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAqpLvD/XFF4834R_chr03880.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAqpLvD/XFF4834R_chr03880.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAqpLvD/XFF4834R_chr03880.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.