Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03870hrpD6XFF4834R_chr03870HrpD6 protein, type III secretion system

hrpD6 XFF4834R_chr03870
XFF4834R_chr03860
XFF4834R_chr03860
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03880
XFF4834R_chr03880
ID hrpD6
AC XFF4834R_chr03870
LT XFF4834R_chr03870
OR XFF4834R_chr from 439575 to 439817 on strand -
DE HrpD6 protein, type III secretion system
IP
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110711)
MW 8785.9 Da
SQ 80 aa
 
........10........20........30........40........50
| | | | |
MFDAMTETVTQDMSKILQTKAMDVSGERLRSIEAALHATAQQLYAHWSAA
SDQVVRNDFTVVHDGINAAREIVAHISGMP
X.species

NP_636596.1 lcl|hrpD6-XCC1222

1

80

S=347 I=81 E=5.11061e-36

HrpD6 protein

X.species

YP_362149.1 lcl|hrpD6-XCV0418

1

80

S=325 I=76 E=2.15041e-33

HrpD6 protein

X.species

NP_640753.1 lcl|hrpD6-XAC0398

1

79

S=320 I=78 E=1.07901e-32

HrpD6 protein

pubmed

1

80

S=417 I=100 E=9.15943e-43

HrpD6

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

80

S=325 I=76 E=1.13849e-31

HrpD6

Pubmed 9781876,11844763

 

prodomImg

pubmed

1

79

S=311 I=75 E=6.01434e-30

HrpD6

Pubmed 16957248

 

prodomImg

pubmed

1

78

S=311 I=77 E=6.39283e-30

HrpD6

Pubmed 12730176

 

prodomImg

pubmed

1

79

S=307 I=73 E=1.98582e-29

HrpD6

Pubmed 11410350

 

prodomImg

PD857461

1

80

S=337 I=80 E=2.4804e-33

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one eC08ojwf)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfTjqsw/XFF4834R_chr03870.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfTjqsw/XFF4834R_chr03870.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfTjqsw/XFF4834R_chr03870.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfTjqsw/XFF4834R_chr03870.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.