Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03860hrpEXFF4834R_chr03860HrpE protein, type III secretion system

hrpE XFF4834R_chr03860
XFF4834R_chr03850
XFF4834R_chr03850
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03870
XFF4834R_chr03870
ID hrpE
AC XFF4834R_chr03860
LT XFF4834R_chr03860
OR XFF4834R_chr from 439217 to 439489 on strand -
DE HrpE protein, type III secretion system
IP
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110711)
MW 9655.7 Da
SQ 90 aa
 
........10........20........30........40........50
| | | | |
MPAIQSLGSMFGQGVDAVTSDLSSRWSSHMTTQASGNQMNNLMGSIGDSA
AQQERMNNYLTTKKNELDFNVALNKFIGKAGDNAKQLVGQ
X.species

NP_636595.1 lcl|hrpE-XCC1221

1

90

S=317 I=71 E=2.5475e-32

HrpE protein

X.species

NP_640752.1 lcl|hrpE-XAC0397

1

90

S=214 I=52 E=7.3706e-20

HrpE protein

X.species

YP_362148.1 lcl|hrpE-XCV0417

1

90

S=214 I=52 E=7.69902e-20

HrpE protein

pubmed

1

90

S=466 I=100 E=9.42978e-49

HrpE

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

90

S=456 I=98 E=1.67513e-47

HrpE

Pubmed 16452423

 

prodomImg

pubmed

1

90

S=333 I=73 E=1.42639e-32

HrpE

Pubmed 16452423

 

prodomImg

pubmed

1

90

S=330 I=73 E=2.743e-32

HrpE

Pubmed 16452423

 

prodomImg

pubmed

1

90

S=329 I=72 E=3.99066e-32

HrpE

Pubmed 16452423

 

prodomImg

PD353375

1

90

S=266 I=61 E=9.74407e-25

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one R9ZW8jAS)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

22 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBad748Z/XFF4834R_chr03860.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBad748Z/XFF4834R_chr03860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBad748Z/XFF4834R_chr03860.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBad748Z/XFF4834R_chr03860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.