Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03830xopF1XFF4834R_chr03830Xanthomonas outer protein F1, type III effector XopF1

xopF1 XFF4834R_chr03830
XFF4834R_chr03820
XFF4834R_chr03820
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03840
XFF4834R_chr03840
ID xopF1
AC XFF4834R_chr03830
LT XFF4834R_chr03830
OR XFF4834R_chr from 436052 to 438061 on strand +
DE Xanthomonas outer protein F1, type III effector XopF1
IP
CL 5.13 Virulence associated GO:0009405
EC
GO InterPro


Curated
PM
AN Type III effector XopF1.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20110713)
MW 70594 Da
SQ 669 aa
 
........10........20........30........40........50
| | | | |
MKLSSDIGTASSSCATSRLPVQPTQTEDVATLREERAPTGPLAGLASSSA
ALRGRRASLADRARPHADEEGPMLGGSHRSESSQSSDATLYTAQIASPPP
ETETSDVPAAAATYAERSTAAAAEVKAQLRARLDALPFAAPSEEQAALQA
SYLEWADARVQERITAFGPGAGYRAVGDMKPEGTKATLPIVYECLRAFIT
GAMRNPIGLATAAAYVGAHAADEEQLSAATLALAGATAGTASYTGDTLLI
PAMDRRARVANLPRFQAIDPKILVPDPPPVILEVTAGGKRFRRLGENSAP
TLAELKAQTYDRRLGITQRQATLEDRSLDTLLLKPAIDGGFNAARRSGSA
RGLLTPAGQLGLSALASGGAGIVQKALLETGKAVARTGQMSVPDLLGGQQ
RLNLFVLALPDKTRRPAQWSDAVHFPPRYLLEIGKEALALARQGFTSANA
VATTARDLLARHMLSNVLVTFASVGAGHMIASPLRGWSNLPVAGELINSK
AVVVQQAIQTLFSDMLWNALKAKNGANTSQAARLDNERAALAAEHQRTIE
RAFEALAEPVDQTIVRLSGPTLAEAERAMEEGVRAAPGPGPLGQTLRMAL
ETLRTEIGRQSVAIATIDAVRTALREGWSQTLSGVPRDAATQALYGELQT
LKRALHDSEELRQWQSGRA
XFF4834R

XFF4834R_chr18460 lcl|XFF4834R_chr19790204_2111493_f1_XFF4834R-XFF4834R_chr18460

243

668

S=1097 I=57 E=4.09337e-126

XFF4834R

XFF4834R_chr_1979 lcl|XFF4834R_chr19780644_2110171_f2_XFF4834R-XFF4834R_chr_1979

128

209

S=276 I=63 E=1.40585e-26

X.species

YP_362145.1 lcl|xopF1-XCV0414

1

669

S=2346 I=71 E=0

outer protein F1

X.species

YP_364673.1 lcl|xopF2-XCV2942

128

618

S=1310 I=56 E=2.71029e-151

outer protein F2

X.species

NP_636592.1 lcl|XCC1218

388

668

S=979 I=68 E=3.61917e-111

hypothetical protein

X.species

NP_643094.1 lcl|XAC2785-XAC2785

512

668

S=115 I=33 E=1.93092e-06

hypothetical protein

pubmed

1

669

S=1972 I=63 E=0

Hpa4

Pubmed 15986924

 

prodomImg

pubmed

1

669

S=1928 I=62 E=0

Hpa4

Pubmed 16957248

 

prodomImg

Iprscan [coil]

531

552

-

Iprscan [seg]

42

64

-

Iprscan [seg]

77

86

-

Iprscan [seg]

109

127

-

Iprscan [seg]

210

221

-

Iprscan [seg]

226

242

-

Iprscan [seg]

357

371

-

PDA0D438

1

387

S=846 I=51 E=7.02338e-95

PD669199

388

551

S=670 I=79 E=1.51257e-73

PD606155

523

668

S=460 I=66 E=3.63629e-48

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QuEUynQL)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMvG6eu/XFF4834R_chr03830.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMvG6eu/XFF4834R_chr03830.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMvG6eu/XFF4834R_chr03830.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMvG6eu/XFF4834R_chr03830.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.