Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03820hpa3XFF4834R_chr03820Hpa3 protein, type III secretion system

hpa3 XFF4834R_chr03820
XFF4834R_chr_0420
XFF4834R_chr_0420
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03830
XFF4834R_chr03830
ID hpa3
AC XFF4834R_chr03820
LT XFF4834R_chr03820
OR XFF4834R_chr from 435609 to 436055 on strand +
DE Hpa3 protein, type III secretion system
IP
CL 4 Transport GO:0005215 GO:0006810
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110711)
MW 15918.3 Da
SQ 148 aa
 
........10........20........30........40........50
| | | | |
MTLESHNRKSANTAFFIGLSACLGLPGELAQRLGEGETILGPAGMLCRVH
TQVEQDELMAFPEVILPLAAREFGGDEVVTLLSLQEQLLTEYGWRLTLSD
LGLLCVCPLLLVRTPEEVAAALDRGQVVARVVLDALATQVDTTMKVAS
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr18440 lcl|XFF4834R_chr19780048_2109494_f3_XFF4834R-XFF4834R_chr18440

1

139

S=344 I=53 E=1.02788e-35

X.species

YP_364674.1 lcl|XCV2943

1

139

S=339 I=53 E=1.49274e-34

hypothetical protein

X.species

YP_362143.1 lcl|XCV0412

1

52

S=262 I=94 E=3.54301e-25

hypothetical protein

X.species

YP_362144.1 lcl|XCV0413

58

148

S=258 I=62 E=9.74106e-25

hypothetical protein

pubmed

1

148

S=518 I=72 E=1.10101e-54

Hpa3

Pubmed 15986924

 

prodomImg

pubmed

1

148

S=518 I=72 E=1.13019e-54

Hpa3

Pubmed 16957248

 

prodomImg

Iprscan [seg]

78

91

-

Iprscan [seg]

98

112

-

PDA210P5

58

148

S=252 I=59 E=3.9908e-23

PDA0P989

1

52

S=239 I=87 E=1.88233e-21

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one CZFvOeZU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkbNuf6/XFF4834R_chr03820.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkbNuf6/XFF4834R_chr03820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkbNuf6/XFF4834R_chr03820.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkbNuf6/XFF4834R_chr03820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.