Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03790hrpFXFF4834R_chr03790HrpF protein, type III secretion system

hrpF XFF4834R_chr03790
XFF4834R_chr03790
XFF4834R_chr03790
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0417
XFF4834R_chr_0417
ID hrpF
AC XFF4834R_chr03790
LT XFF4834R_chr03790
OR XFF4834R_chr from 431219 to 433636 on strand -
DE HrpF protein, type III secretion system
IP NolX
CL 4.3.A.6 The Type III (Virulence-related) Secretory Pathway (IIISP) Family GO:0030254 GO:0015448
EC
GO InterPro
Biological Process: nodulation (GO:0009877)

Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110711)
MW 85862.7 Da
SQ 805 aa
 
........10........20........30........40........50
| | | | |
MSLNTLSTGSNPSQLLGTPLNESDSSELFGSDSSKDDSDLQSTMDDIFLL
IYQLLAALQTNTPTSASSNAFNDAPANAPSGDASTPSSASDDQANQPIEK
RTSWPSLGYDFDPKDIKGKDAPPALEGSTVTWNGGTLTPSELQIVSTLNA
HKDQMPLEYKNLDDKINDPSTPADLKAALQGLKQDPRLFFAIGSQGDGKC
GGKIKAQDLWDFSDSHPQVKAMGGKNDQFNPKDIKGSTPPPAVDGSSVTW
DGGTLTQNELEIVSTLNRHKDQCPLKWSDLDAKINDASTPPDLKKALTDL
QSDPRLFFAIGSQGDGKCGGKITDGDLGNFASHHAQVAEYADKQAKNYTQ
NYVASDSPDKTKASVMTESDAMRELYRYSDYLPDDLNQDTFKSLVDGESS
TKKCPPQVIAAAQYFRDHPDQWKALAGDSGSMSKPDFLQKASSQIHLTAD
EQKTLDTINSHQDAFYGDGKEVTRDKLETISKDDKADPAVKQAATQLLAD
PLLFGLLNNSITGYKKPHHFFGGGHVVDSGKISQNDFRQFYDHMSAANKT
VDTPATHEASSPDQQKAVADMLVGKDDPPAIKKPKKDVGTFQHGLHEFLK
WDAKILDWMSVGLSALNGIPIIGEITDAASIALESEAQAAQVVDTAIQGG
DMSLALKLAGINMAGAVVGAVGGPTARIGAKAVAKGVAEAAAKGTAEGAA
KGTAKGVAKGAGKTAAERPSAAEFAKGYVGGTAISKSVEILKTPVLAGLH
YEEYQLDKQKDGEIHQKMENAGGIPMGKQIVPTDIANNFEGDLRQNLRNI
RVRRR
X.species

NP_640749.1 lcl|hrpF-XAC0394

1

792

S=3516 I=85 E=0

HrpF protein

X.species

YP_362142.1 lcl|hrpF-XCV0411

1

792

S=3124 I=77 E=0

HrpF protein

X.species

NP_636591.1 lcl|hrpF-XCC1217

110

792

S=2326 I=64 E=0

HrpF protein

X.species

NP_636591.1 lcl|hrpF-XCC1217

1

367

S=997 I=57 E=2.82264e-113

HrpF protein

pubmed

1

792

S=3716 I=90 E=0

HrpF

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

792

S=3528 I=85 E=0

HrpF

Pubmed 12730176

 

prodomImg

pubmed

1

792

S=3124 I=77 E=0

HrpF

Pubmed 11844763

 

prodomImg

pubmed

1

792

S=3029 I=74 E=0

Type III secretion system component

Pubmed 15986924

 

prodomImg

pubmed

1

792

S=3014 I=74 E=0

HrpF1

Pubmed 16957248

 

prodomImg

sp

240

678

S=1185 I=51 E=1.38459e-134

Nodulation outer protein X ; Plasmid Secreted

 

prodomImg

sp

121

222

S=355 I=63 E=5.1392e-34

Nodulation outer protein X ; Plasmid Secreted

 

prodomImg

sp

240

574

S=1049 I=58 E=3.82232e-118

Nodulation protein nolX ; Plasmid

 

prodomImg

sp

121

222

S=358 I=63 E=2.02181e-34

Nodulation protein nolX ; Plasmid

 

prodomImg

Iprscan IPR008718 [PF05819]

35

221

NolX

Iprscan IPR008718 [PF05819]

240

623

NolX

PD018329

368

574

S=828 I=75 E=1.32434e-92

PD356420

1

136

S=473 I=74 E=1.36992e-49

PD069092

718

792

S=289 I=70 E=2.60911e-27

PD025268

590

678

S=255 I=57 E=3.62183e-23

PD142375

136

189

S=224 I=81 E=1.97792e-19

PD142375

254

307

S=222 I=80 E=3.08546e-19

PD285261

308

367

S=222 I=74 E=3.90442e-19

PD285261

190

254

S=200 I=64 E=1.58657e-16

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VCu2kJbk)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBL6eVs0/XFF4834R_chr03790.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBL6eVs0/XFF4834R_chr03790.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBL6eVs0/XFF4834R_chr03790.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBL6eVs0/XFF4834R_chr03790.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.