Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03780xopAEXFF4834R_chr03780Xanthomonas outer protein AE, type III effector XopAE

xopAE XFF4834R_chr03780
XFF4834R_chr_0414
XFF4834R_chr_0414
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03790
XFF4834R_chr03790
ID xopAE
AC XFF4834R_chr03780
LT XFF4834R_chr03780
OR XFF4834R_chr from 428655 to 430667 on strand -
DE Xanthomonas outer protein AE, type III effector XopAE
IP Leucine-rich repeat;
CL 5.13 Virulence associated GO:0009405
EC
GO InterPro
Molecular Function: protein binding (GO:0005515)

Curated
PM
AN Leucine rich hrp associated protein, anciennement hpaF, proteine correspondant chez Xav a HpaF et HpaG
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20110209)
MW 74017.4 Da
SQ 670 aa
 
........10........20........30........40........50
| | | | |
MFNINRLLRSRPRTDTADQAPAEDRPSRQPSAAEGLLSPLLARPRRREST
SAAGTSAPRNPGPRSPFRSPLRPSGQPAARAGASSAPPHSIEHDIDDWLA
RSLPMAEGVRTGYNLYDGQRDTSREVLQNAADAIRRAATLQSTELVLDHG
FPATTLPDAVGRLDALQKLALFHTGLQSLPDSLGQLRQLRHLRVVGAPDL
KKLPPSLTRLSNLRTLQLIMTPLDELPADMWRMQGLRSLTLGGGHYARLP
ARIVELSRLTELSMVHSSHFRELPENIGLMQGLRSLEVTSNSELEQLPGS
LTRLHRLEKLNLSSNRRLAHLPENIGQLRGLTELSLKHCAALGELPDSVG
DLAQLQLLDLRGTGLQTLPQSLARLPARCDIKVPEHLADQLLQIRDPERA
AREAQRAAQRLADRRRRAPVPAAQAAGSSWNRVPEFTRALRSVDADLGER
FDKWAQGLAQNARMFGAAITAAEMPLLYQVVAEALRSPEFRSNFGQFLSD
HTVKTLNMDGMTQVGGFGPAVRGDVKTAFAEMLKHKLMHTQDHETALHLL
QEALQNPDLGLSRERLLRSRNALNGHAEMWPPLKAYISMHDVEGEAAQDA
AIKWAMAQLDEAHEGVISEADAKKESEQAQANANRFIERRARVLLGEWAS
VRPWCAAMSRPAVKNEQACW
XFF4834R

XFF4834R_chr15400 lcl|XFF4834R_chr16550175_1774890_r1_XFF4834R-XFF4834R_chr15400

127

393

S=257 I=35 E=2.87366e-24

X.species

NP_640748.2 lcl|hpaF-XAC0393

105

648

S=2100 I=78 E=0

HpaF protein

X.species

YP_362139.1 lcl|hpaG-XCV0408

220

649

S=1650 I=77 E=0

HpaG LRR protein

X.species

YP_362139.1 lcl|hpaG-XCV0408

176

301

S=158 I=34 E=1.13124e-11

HpaG LRR protein

X.species

YP_362139.1 lcl|hpaG-XCV0408

156

241

S=102 I=35 E=5.64783e-05

HpaG LRR protein

X.species

YP_362140.1 lcl|hpaF-XCV0409

1

175

S=508 I=60 E=4.07961e-54

HpaF protein

X.species

NP_639520.1 lcl|XCC4186

127

393

S=257 I=33 E=9.59789e-24

leucin rich protein

X.species

NP_643399.2 lcl|XAC3090-XAC3090

119

393

S=250 I=35 E=6.88535e-23

leucin rich protein

X.species

YP_364951.1 lcl|XCV3220

151

393

S=239 I=36 E=1.67412e-21

hypothetical protein

X.species

NP_637913.1 lcl|XCC2565

269

375

S=144 I=36 E=5.97604e-10

leucin rich protein

X.species

NP_637913.1 lcl|XCC2565

239

360

S=127 I=30 E=5.81204e-08

leucin rich protein

pubmed

1

670

S=2915 I=87 E=0

HpaF

Pubmed 15812033,18326683

 

prodomImg

pubmed

1

648

S=2315 I=73 E=0

HpaF

Pubmed 12730176

 

prodomImg

pubmed

1

649

S=2253 I=72 E=0

Leucine rich hrp associated protein

Pubmed 15986924

 

prodomImg

pubmed

1

649

S=2252 I=72 E=0

Hrp-associated protein

Pubmed 11410350

 

prodomImg

pubmed

1

649

S=2142 I=71 E=0

HpaF

Pubmed 16957248

 

prodomImg

pubmed

220

649

S=1650 I=77 E=0

HpaG

Pubmed 11844763

 

prodomImg

pubmed

176

301

S=158 I=34 E=4.48246e-10

HpaG

Pubmed 11844763

 

prodomImg

pubmed

1

175

S=508 I=60 E=1.61652e-52

HpaF

Pubmed 11844763

 

prodomImg

pubmed

127

375

S=302 I=34 E=1.43835e-27

NBS-LRR disease resistance protein homologue ; ATP-binding Nucleotide-binding

Pubmed 12715163

 

prodomImg

pubmed

127

375

S=299 I=34 E=3.43965e-27

NBS-LRR disease resistance protein homologue ; ATP-binding Nucleotide-binding

Pubmed 12715163

 

prodomImg

Iprscan [G3DSA:3.80.10.10]

156

365

-

Iprscan [PTHR23155]

154

375

-

Iprscan [PTHR23155:SF37]

154

375

-

Iprscan IPR001611 [PF00560]

354

375

Leucine-rich repeat

Iprscan IPR001611 [PF00560]

306

328

Leucine-rich repeat

PD565437

362

649

S=1097 I=73 E=2.55607e-125

PD539916

1

153

S=443 I=62 E=5.43066e-46

PD687097

220

272

S=234 I=87 E=9.53854e-21

PDA2W3D2

273

317

S=204 I=93 E=4.90069e-17

PDA9A0T0

339

393

S=133 I=54 E=1.62141e-08

Iprscan [SSF52058]

117

376

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one BFltkEqu)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

479 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0TcH7D/XFF4834R_chr03780.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0TcH7D/XFF4834R_chr03780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0TcH7D/XFF4834R_chr03780.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0TcH7D/XFF4834R_chr03780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.