Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03490XFF4834R_chr03630574_0402362_f3_XFF4834R-XFF4834R_chr03490XFF4834R_chr03490Putative CoA-transferase protein conserved

XFF4834R_chr03630574_0402362_f3_XFF4834R-XFF4834R_chr03490 XFF4834R_chr03490
XFF4834R_chr03480
XFF4834R_chr03480
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03500
XFF4834R_chr03500
ID XFF4834R_chr03630574_0402362_f3_XFF4834R-XFF4834R_chr03490
AC XFF4834R_chr03490
LT XFF4834R_chr03490
OR XFF4834R_chr from 401574 to 402362 on strand +
DE Putative CoA-transferase protein conserved
IP Coenzyme A transferase
CL 1.5.3.5 Coenzyme A GO:0015937
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: CoA-transferase activity (GO:0008410)

Curated
PM
AN s appelle gctB chez xav xac et xcc mais je n ai rien trouve pour le valider
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100719)
MW 27087.3 Da
SQ 262 aa
 
........10........20........30........40........50
| | | | |
MSAYSTNEMMTVAAARRLPDGAVCFVGIGLPSTAANLARLTHAPDVTLIY
ESGPIGARPQVLPLSIGDGELAETADTVVSTPEIFRYWLQGGRVDVGFLG
AAQIDRHANLNTTVIGSYEAPKTRLPGAGGAPEIAASAKQVFIIMRQSTR
SFVSSLDFITTVGHLDGGDARARAGLPGAGPTVVVTNLCVMEPDPVTCEL
TVTSLHPGTTREQVSAATGWPIRFAADLAQTTPPSSAELDALRALQARTD
AAHGAQAAGAQA
XFF4834R

XFF4834R_chr34710 lcl|atoA-XFF4834R_chr34710

6

151

S=133 I=29 E=1.00687e-09

acetyl-CoA:acetoacetyl-CoA transferase, beta subunit

X.species

NP_640721.1 lcl|gctB-XAC0365

1

250

S=1146 I=90 E=6.88859e-132

glutaconate CoA transferase subunit B

X.species

YP_362110.1 lcl|gctB-XCV0379

1

250

S=1134 I=89 E=1.97667e-130

glutaconate CoA transferase subunit B

X.species

NP_635760.1 lcl|gctB-XCC0365

1

249

S=1056 I=83 E=5.34711e-121

glutaconate CoA transferase subunit B

X.species

lcl|lpsJ-XALc_2690

6

151

S=135 I=29 E=2.26093e-09

probable succinyl-coa:3-ketoacid-coenzyme a transferase subunit b protein

X.species

YP_365432.1 lcl|wxcJ-XCV3701

6

151

S=133 I=31 E=3.52694e-09

3-oxoacid CoA transferase beta subunit

X.species

NP_643884.1 lcl|ipsJ-XAC3577

1

151

S=132 I=29 E=5.04249e-09

IpsJ protein

X.species

NP_636020.1 lcl|ipsJ-XCC0628

6

151

S=130 I=29 E=8.50815e-09

IpsJ protein

X.species

lcl|pcaJ-XALc_3032

15

156

S=128 I=31 E=1.67951e-08

probable 3-oxoadipate coa-transferase subunit b protein

pubmed

1

249

S=907 I=69 E=2.2318e-101

3-oxoadipate CoA-transferase subunit B EC=2.8.3.6 ; Aromatic hydrocarbons catabolism

Pubmed 11741863,11741862

 

prodomImg

pubmed

4

249

S=771 I=58 E=7.86471e-85

Putative acetoacetyl-CoA transferase beta-subunit

Pubmed 15066829

 

prodomImg

pubmed

4

222

S=272 I=31 E=2.16708e-24

Glutaconate CoA-transferase subunit B EC=2.8.3.12 ; Cytoplasm

Pubmed 7957258,9083111

 

prodomImg

pubmed

4

245

S=227 I=31 E=6.94151e-19

Putative acyl-CoA transferase

Pubmed 15599705

 

prodomImg

pubmed

1

246

S=199 I=29 E=1.46557e-15

TesB, ORF1, ORF2, ORF3 genes, complete cds

Pubmed 11739769

 

prodomImg

sp

1

249

S=907 I=69 E=1.52098e-101

3-oxoadipate CoA-transferase subunit B EC=2.8.3.6 ; Aromatic hydrocarbons catabolism

 

prodomImg

sp

4

222

S=272 I=31 E=1.47687e-24

Glutaconate CoA-transferase subunit B EC=2.8.3.12 ; Cytoplasm

 

prodomImg

sp

8

245

S=149 I=26 E=1.1034e-09

Putative CoA-transferase subunit beta Mb3582 EC=2.8.3.-

 

prodomImg

sp

8

245

S=149 I=26 E=1.1034e-09

Putative CoA-transferase subunit beta Rv3552/MT3656 EC=2.8.3.-

 

prodomImg

sp

6

151

S=130 I=29 E=2.37258e-07

Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B EC=2.8.3.5 ; Lipopolysaccharide biosynthesis

 

prodomImg

Iprscan [G3DSA:3.40.810.20]

2

244

-

Iprscan [PTHR13707:SF1]

14

151

-

Iprscan IPR004165 [PTHR13707]

14

151

Coenzyme A transferase

Iprscan IPR004165 [PF01144]

7

216

Coenzyme A transferase

Iprscan IPR004165 [SM00882]

8

217

Coenzyme A transferase

Iprscan [seg]

165

181

-

Iprscan [seg]

251

262

-

PD488617

27

141

S=159 I=35 E=9.79382e-12

PD713456

90

163

S=156 I=45 E=1.81884e-11

PD004976

8

245

S=148 I=27 E=1.7859e-10

Iprscan [SSF100950]

1

245

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one HkP75NaP)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

19 hits
swiss-prot

Swiss-Prot ncbi-blastp

14 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeWmhcR/XFF4834R_chr03490.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeWmhcR/XFF4834R_chr03490.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeWmhcR/XFF4834R_chr03490.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeWmhcR/XFF4834R_chr03490.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.