Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03340XFF4834R_chr03460209_0384474_f1_XFF4834R-XFF4834R_chr03340XFF4834R_chr03340putative metal-dependent phosphohydrolase

XFF4834R_chr03460209_0384474_f1_XFF4834R-XFF4834R_chr03340 XFF4834R_chr03340
XFF4834R_chr03330
XFF4834R_chr03330
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03350
XFF4834R_chr03350
ID XFF4834R_chr03460209_0384474_f1_XFF4834R-XFF4834R_chr03340
AC XFF4834R_chr03340
LT XFF4834R_chr03340
OR XFF4834R_chr from 383227 to 384474 on strand +
DE putative metal-dependent phosphohydrolase
IP Metal-dependent phosphohydrolase, HD domain;
CL 10.2 Conserved hypothetical protein
EC
GO InterPro
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110701)
MW 45892.2 Da
SQ 415 aa
 
........10........20........30........40........50
| | | | |
MLRTIDSDQLRPGMYVYKLLGAWVHHPFWKTSFLVDSEDVEKIHDSRIEQ
LVIDTARGLDVEAPTTSGASAGPGVPPSPAPAAPEPPEPAATSRSVRTNS
VTAQVGIDAEVVRARRIFEDGRDMVEAMFRDVRLGRTVDTEAAMPLVEAI
NDSVLRHPQALISVARLKTADDYTYLHSMAVAGLMSGLARQLGLPESQVV
EAAMGGLLHDMGKAVTPLEILNKPGRLTNEEMEVMRKHPLDGHRLLVAGG
VQNAVVLEIALHHHEKMDGSGYPNQLVGENISLMSRMGAVCDVYDAISSD
RPYKRGWDPAESLKQMASWKGHFDPVVFQAFVRRLGIYPVGSLVRLESQK
LAVVIEQTPDSLLKPKVRVFYSARLRSHVLVQDIDLSRPDCHDRIAQMES
PAEWGFRDLEKLWLP
XFF4834R

XFF4834R_chr20160 lcl|XFF4834R_chr_2312560_2313696_f1_XFF4834R-XFF4834R_chr20160

146

333

S=332 I=43 E=1.26926e-33

XFF4834R

XFF4834R_chr24790 lcl|XFF4834R_chr27140430_2864416_f2_XFF4834R-XFF4834R_chr24790

161

331

S=248 I=38 E=1.98071e-23

X.species

NP_640706.1 lcl|XAC0350-XAC0350

1

415

S=2000 I=92 E=0

hypothetical protein

X.species

YP_362094.1 lcl|XCV0363

1

415

S=1980 I=91 E=0

putative metal-dependent phosphohydrolase superfamily protein

X.species

NP_635745.1 lcl|XCC0350

1

415

S=1781 I=83 E=0

hypothetical protein

X.species

NP_642203.1 lcl|rpfG-XAC1877

146

333

S=332 I=44 E=4.45608e-33

response regulator

X.species

YP_363648.1 lcl|rpfG-XCV1917

146

333

S=332 I=43 E=4.77798e-33

two-component system response regulator RpfG

X.species

lcl|rpfG-XALc_1345

168

333

S=329 I=47 E=1.10344e-32

probable two component system response regulator rpfg protein

X.species

NP_637219.1 lcl|rpfG-XCC1854

146

333

S=328 I=43 E=1.33676e-32

response regulator

X.species

NP_637715.1 lcl|XCC2361

171

331

S=262 I=39 E=1.73993e-24

two-component system regulatory protein

X.species

YP_364403.1 lcl|XCV2672

161

331

S=256 I=39 E=9.04028e-24

two-component system response regulator

X.species

NP_642808.1 lcl|XAC2493-XAC2493

161

331

S=248 I=38 E=7.52147e-23

two-component system regulatory protein

X.species

lcl|XALc_1975

208

331

S=220 I=42 E=1.84172e-19

probable two-component system response regulator protein

pubmed

114

414

S=919 I=56 E=1.44307e-102

Putative uncharacterized protein ofn41 ; Plasmid

Pubmed 15995187

 

prodomImg

pubmed

146

333

S=328 I=43 E=5.6823e-31

Response regulator rpfG ; Phosphoprotein Transducer Two-component regulatory system Virulence

Pubmed 11123673

 

prodomImg

pubmed

120

333

S=303 I=33 E=7.04853e-28

Putative uncharacterized protein

Pubmed 16309397

 

prodomImg

pubmed

126

369

S=280 I=28 E=4.42921e-25

BH0008 protein ORF14

Pubmed 10427704

 

prodomImg

pubmed

164

335

S=277 I=36 E=9.7926e-25

Putative response regulator

Pubmed 15995209

 

prodomImg

sp

146

333

S=328 I=43 E=3.86676e-31

Response regulator rpfG ; Phosphoprotein Transducer Two-component regulatory system Virulence

 

prodomImg

sp

125

356

S=281 I=26 E=2.46638e-25

Uncharacterized protein BB_0374

 

prodomImg

sp

171

335

S=244 I=35 E=7.05953e-21

Uncharacterized protein aq_2027

 

prodomImg

Iprscan IPR021812 [PF11871]

1

143

Protein of unknown function DUF3391

Iprscan IPR006674 [PF01966]

175

296

Metal-dependent phosphohydrolase, HD subdomain

Iprscan IPR003607 [SM00471]

170

306

Metal-dependent phosphohydrolase, HD domain

Iprscan IPR006675 [TIGR00277]

170

265

HDIG

Iprscan [seg]

67

91

-

PDA0G1Q8

177

367

S=188 I=27 E=2.37847e-15

PD399744

113

173

S=176 I=54 E=6.70701e-14

PDA1U4H6

387

415

S=160 I=97 E=6.69582e-12

PD280606

338

388

S=155 I=61 E=2.51972e-11

PD110558

171

235

S=151 I=51 E=7.55879e-11

PD583276

1

60

S=137 I=46 E=4.51152e-09

PD110559

290

406

S=137 I=25 E=4.55103e-09

PDA9P8U2

154

334

S=124 I=22 E=1.59589e-07

PD013582

290

335

S=117 I=45 E=1.06773e-06

PD814938

208

319

S=117 I=25 E=1.08651e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QeDUvOMP)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

14 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKjcXBV/XFF4834R_chr03340.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKjcXBV/XFF4834R_chr03340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKjcXBV/XFF4834R_chr03340.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKjcXBV/XFF4834R_chr03340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.