Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03310XFF4834R_chr_0380756_0381301_r3_XFF4834R-XFF4834R_chr03310XFF4834R_chr03310putative transferase

XFF4834R_chr_0380756_0381301_r3_XFF4834R-XFF4834R_chr03310 XFF4834R_chr03310
XFF4834R_chr03300
XFF4834R_chr03300
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03320
XFF4834R_chr03320
ID XFF4834R_chr_0380756_0381301_r3_XFF4834R-XFF4834R_chr03310
AC XFF4834R_chr03310
LT XFF4834R_chr03310
OR XFF4834R_chr from 380756 to 381301 on strand -
DE putative transferase
IP Bacterial transferase hexapeptide repeat;
CL 1 Metabolism GO:0008152
EC
GO InterPro
Molecular Function: transferase activity (GO:0016740)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100420)
MW 19207.8 Da
SQ 181 aa
 
........10........20........30........40........50
| | | | |
MTPIRSFLDHTPQLGARVYVDPACTIIGKVSLGDDVSVWPGTVIRGDVNH
VQIGARTNVQDGTIIHVSHHSPFNKAGYPTVIGEDVTVGHGTILHACTIE
DLCLIGMGACVLDGATVRRYGFVGAGAVVGPGKVVGEAELWLGNPARLAR
TLSDKEIESLHYSAQHYVRLKDQYLGASPAS
Show or not Domain decomposition
 
X.species

NP_640704.1 lcl|XAC0348-XAC0348

1

181

S=827 I=88 E=1.68071e-93

transferase

X.species

YP_362091.1 lcl|XCV0360

1

180

S=806 I=87 E=5.83765e-91

putative transferase

X.species

NP_635743.1 lcl|XCC0348

1

180

S=770 I=83 E=1.37928e-86

transferase

X.species

lcl|XALc_0340

1

178

S=711 I=76 E=1.94345e-79

putative transferase protein

pubmed

1

176

S=659 I=72 E=1.48224e-71

Putative uncharacterized protein

Pubmed 17263848

 

prodomImg

pubmed

4

171

S=408 I=47 E=3.61094e-41

Transferase

Pubmed 11108008

 

prodomImg

pubmed

4

171

S=380 I=45 E=8.84183e-38

Putative carbonic anhydrase/acetyltransferase

Pubmed 18217940

 

prodomImg

pubmed

4

175

S=316 I=38 E=5.53294e-30

Hypothetical ferripyochelin binding protein

Pubmed 11587856

 

prodomImg

pubmed

12

176

S=309 I=40 E=3.93477e-29

Gamma-carbonic anhydrase

Pubmed 15470248

 

prodomImg

pubmed

12

174

S=279 I=36 E=1.36553e-25

Putative transcription factor APF1-like protein

Pubmed 16391035

 

prodomImg

pubmed

9

174

S=264 I=35 E=9.12846e-24

Putative acyltransferase

Pubmed 17504494

 

prodomImg

pubmed

12

156

S=240 I=35 E=7.32229e-21

Uncharacterized protein At5g63510, mitochondrial ; Mitochondrion

Pubmed 9501997

 

prodomImg

pubmed

4

175

S=237 I=31 E=1.9957e-20

Putative gamma-type carbonic anhydrase

Pubmed 17659451

 

prodomImg

pubmed

4

165

S=220 I=30 E=1.94093e-18

Gamma carbonic anhydrase

Pubmed 16885304

 

prodomImg

sp

4

175

S=429 I=48 E=7.4156e-44

Protein yrdA

 

prodomImg

sp

4

175

S=429 I=48 E=7.4156e-44

Protein yrdA

 

prodomImg

sp

13

172

S=270 I=36 E=1.29767e-24

Uncharacterized protein MJ0304

 

prodomImg

sp

19

174

S=253 I=35 E=1.47651e-22

Uncharacterized protein PA3753

 

prodomImg

sp

12

156

S=240 I=35 E=5.08813e-21

Uncharacterized protein At5g63510, mitochondrial ; Mitochondrion

 

prodomImg

Iprscan [G3DSA:2.160.10.10]

4

167

-

Iprscan IPR001451 [PF00132]

11

28

Bacterial transferase hexapeptide repeat

Iprscan IPR001451 [PF00132]

29

46

Bacterial transferase hexapeptide repeat

Iprscan IPR001451 [PF00132]

50

67

Bacterial transferase hexapeptide repeat

Iprscan IPR001451 [PF00132]

79

96

Bacterial transferase hexapeptide repeat

Iprscan IPR001451 [PF00132]

102

119

Bacterial transferase hexapeptide repeat

Iprscan IPR001451 [PF00132]

120

137

Bacterial transferase hexapeptide repeat

Iprscan [seg]

117

136

-

PD013088

4

175

S=189 I=32 E=1.97585e-15

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one uDfdGdgU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

45 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0wAaIr/XFF4834R_chr03310.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0wAaIr/XFF4834R_chr03310.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0wAaIr/XFF4834R_chr03310.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0wAaIr/XFF4834R_chr03310.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.