Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03230TXfu1XFF4834R_chr03230Xfu1 transposase

TXfu1 XFF4834R_chr03230
XFF4834R_chr03210
XFF4834R_chr03210
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03240
XFF4834R_chr03240
ID TXfu1
AC XFF4834R_chr03230
LT XFF4834R_chr03230
OR XFF4834R_chr from 373047 to 374030 on strand +
DE Xfu1 transposase
IP Transposase, IS4-like
CL 8.3.1 transposases GO:0004803
EC
GO InterPro
DNA-mediated (GO:0006313)
Molecular Function: transposase activity (GO:0004803)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN ISXfu1 has 92% nucleotide identity with IS1051 that belongs to IS5 family and IS5 group. There are 26 insertions or remnants of ISXfu1. No copy is plasmidic. Six copies of ISXfu1 are 1162 bp long and some copies show little sequence variation with intact IR (5 copies are 1161, 2 copies 1163, 1 copy 1165 and 1 copy 1160 bp long). Remaining copies are truncated, mostly in the right inverted repeat, due to the insertion of ISXax1 or in one case to a new insertion of ISXfu1. A 327 aa long transposase gene is conserved in 13 copies and is annotated as TXfu1 (Xfu1 transposase) and a 328 aa transposase gene (XFF4834R_chr01820) with a 26 aa divergent region is present in another copy of ISXfu1. Remaining copies contain truncated transposase genes or transposase genes with frameshifts that are not annotated as a gene.
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120926)
MW 37632.3 Da
SQ 327 aa
 
........10........20........30........40........50
| | | | |
MQLTFGDAEYDGKRKRTRREVFMAEMEQVVPWKELLGLIEPHYPKSGQPG
RQPYRLETMLRIHFLQQWYALSDPSAEEALYDTVSMRRFAKIGGLDEVPD
ETTILNFRHLLEQHDLARKLFNRVNAHLSRKGQSLRGGTIVDATIISAPS
STKNKDGERDPEMRQTKKGNQYFFGMKAHIGVDDESGLVHHVECTAANVA
DITQAHKLLHGKEDTVCGDSGYTGLEKRDEIKGKRKLRYLIAEKPSKLKQ
IKNKRELKLAKRWEHTKASLRAKVEHPFRVIKRQFGYAKVRYRGLVKNTA
QVLTLFALSNLWLKRKRLMPAVGKLCL
XFF4834R

XFF4834R_chr42010 lcl|insH-XFF4834R_chr42010

1

327

S=1744 I=99 E=0

IS5 transposase and trans-activator

XFF4834R

XFF4834R_chr31110 lcl|insH-XFF4834R_chr31110

1

327

S=1744 I=99 E=0

IS5 transposase and trans-activator

XFF4834R

XFF4834R_chr28990 lcl|insH-XFF4834R_chr28990

1

327

S=1744 I=99 E=0

IS5 transposase and trans-activator

XFF4834R

XFF4834R_chr28500 lcl|insH-XFF4834R_chr28500

1

327

S=1744 I=99 E=0

IS5 transposase and trans-activator

XFF4834R

XFF4834R_chr25910 lcl|insH-XFF4834R_chr25910

1

327

S=1744 I=99 E=0

IS5 transposase and trans-activator

XFF4834R

XFF4834R_chr19490 lcl|insH-XFF4834R_chr19490

1

327

S=1744 I=99 E=0

IS5 transposase and trans-activator

XFF4834R

XFF4834R_chr18900 lcl|insH-XFF4834R_chr18900

1

327

S=1744 I=99 E=0

IS5 transposase and trans-activator

XFF4834R

XFF4834R_chr15880 lcl|insH-XFF4834R_chr15880

1

327

S=1744 I=99 E=0

IS5 transposase and trans-activator

XFF4834R

XFF4834R_chr01570 lcl|insH-XFF4834R_chr01570

1

327

S=1744 I=99 E=0

IS5 transposase and trans-activator

XFF4834R

XFF4834R_chr01030 lcl|insH-XFF4834R_chr01030

1

327

S=1744 I=99 E=0

IS5 transposase and trans-activator

X.species

NP_637822.1 lcl|XCC2470

1

327

S=1298 I=73 E=3.40573e-150

IS1479 transposase

X.species

NP_638931.1 lcl|XCC3585

1

327

S=1293 I=73 E=1.33872e-149

IS1479 transposase

X.species

NP_638649.1 lcl|XCC3303

1

327

S=1293 I=73 E=1.33872e-149

IS1479 transposase

X.species

NP_636979.1 lcl|XCC1609

1

327

S=1293 I=73 E=1.33872e-149

IS1479 transposase

X.species

NP_635522.1 lcl|XCC0127

1

327

S=1293 I=73 E=1.33872e-149

IS1479 transposase

X.species

NP_636622.1 lcl|XCC1248

1

327

S=1291 I=73 E=2.66578e-149

IS1479 transposase

X.species

YP_365907.1 lcl|XCV4176

1

327

S=1291 I=73 E=2.68913e-149

IS1479 transposase

X.species

YP_365126.1 lcl|XCV3395

1

327

S=1291 I=73 E=2.68913e-149

IS1479 transposase

X.species

YP_363025.1 lcl|XCV1294

1

327

S=1291 I=73 E=2.68913e-149

IS1479 transposase

X.species

YP_362353.1 lcl|XCV0622

1

327

S=1291 I=73 E=2.68913e-149

IS1479 transposase

pubmed

1

323

S=1277 I=73 E=5.08182e-146

Putative transposase

Pubmed 10940020

 

prodomImg

pubmed

2

325

S=1109 I=64 E=8.96316e-126

IS2000 transposase Transposase

Pubmed 10427724,10049269

 

prodomImg

pubmed

2

327

S=1085 I=63 E=8.70991e-123

Transposase ; Plasmid

Pubmed 15995187

 

prodomImg

pubmed

2

327

S=1078 I=63 E=6.30304e-122

TnpA

Pubmed 16870796

 

prodomImg

pubmed

2

327

S=1075 I=63 E=1.41806e-121

Transposase ; Plasmid

Pubmed 12547188,15466034

 

prodomImg

pubmed

2

327

S=1072 I=62 E=3.45079e-121

Transposase ; Plasmid

Pubmed 11371531,9244273

 

prodomImg

pubmed

2

327

S=1072 I=62 E=3.45079e-121

Transposase ; Plasmid

Pubmed 12177326,15288784

 

prodomImg

pubmed

2

327

S=1071 I=62 E=4.03716e-121

DDE-type transposase

Pubmed 18487340

 

prodomImg

pubmed

2

327

S=1067 I=62 E=1.16958e-120

Transposase like protein TnpA1

Pubmed 10433976

 

prodomImg

pubmed

2

327

S=1067 I=62 E=1.25407e-120

Transposase

Pubmed 11371531,9244273

 

prodomImg

Iprscan IPR002559 [PF01609]

135

313

Transposase, IS4-like

PDA839M8

21

94

S=213 I=54 E=2.96833e-18

PD186263

99

154

S=211 I=75 E=4.63046e-18

PD974827

215

256

S=191 I=90 E=1.13477e-15

PDA872X8

145

225

S=186 I=49 E=5.12831e-15

PD621928

257

289

S=153 I=85 E=5.11121e-11

PD007264

59

95

S=144 I=70 E=6.57612e-10

PD004652

181

214

S=142 I=79 E=9.82084e-10

PD688766

290

323

S=139 I=74 E=2.49635e-09

PD228130

26

58

S=133 I=70 E=1.24171e-08

PDA2X8R0

1

51

S=132 I=48 E=1.69956e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one UFOrkB4X)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

79 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

59 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0TQvkU/XFF4834R_chr03230.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0TQvkU/XFF4834R_chr03230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0TQvkU/XFF4834R_chr03230.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB0TQvkU/XFF4834R_chr03230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.