Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03100metEXFF4834R_chr03100putative 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase

metE XFF4834R_chr03100
XFF4834R_chr03090
XFF4834R_chr03090
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03110
XFF4834R_chr03110
ID metE
AC XFF4834R_chr03100
LT XFF4834R_chr03100
OR XFF4834R_chr from 362130 to 363068 on strand +
DE putative 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase
IP Methionine synthase, vitamin-B12 independent
CL 1.5.1.9 Methionine GO:0009086
EC
GO InterPro
Biological Process: methionine biosynthetic process (GO:0009086)
Molecular Function: 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity (GO:0003871)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120320)
MW 34904.3 Da
SQ 312 aa
 
........10........20........30........40........50
| | | | |
MQDAELIEGKQDALRLSLQEQQHAGIDIVSDGEQTRQHFVTTFIEHLSGV
DFEKRETVRIRDRYDASVPTVVGAVSRPRSVFVDDAKFLRQQTGQPIKWA
LPGPMTMIDTLFDAHYKSREKLAWEFAKILNQEARELEAAGVDIIQFDEP
AFNVFFDEVNDWGVATLERAVEGLKCETAVHICYGYGIKANTDWKQTLGS
EWRQYEESFPKLQTSSLDIISLECHNSHVPIDLIELVRGKKVMVGAIDVA
STTIETPQEVAETLRKALRFVDADKLYPSTNCGMAPLARHVARGKLSALS
AGAQIVRGELSA
X.species

NP_640692.1 lcl|metE-XAC0336

1

312

S=1653 I=99 E=0

5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase

X.species

YP_362076.1 lcl|metE-XCV0345

1

312

S=1626 I=97 E=0

5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase

X.species

NP_635713.1 lcl|metE-XCC0318

1

312

S=1588 I=94 E=0

5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase

X.species

lcl|metE-XALc_0169

21

309

S=238 I=29 E=7.70531e-22

probable5-methyltetrahydropteroyltriglutamate--homocysteine s-methyltransferase protein

pubmed

1

311

S=1423 I=83 E=7.72805e-164

MetE

Pubmed 11479715

 

prodomImg

pubmed

3

311

S=323 I=32 E=1.82027e-30

2-hydroxypropyl-CoM lyase EC=4.4.1.23 ; Metal-binding Plasmid Zinc

Pubmed 7704278,9405410

 

prodomImg

pubmed

1

312

S=313 I=31 E=2.40404e-29

Epoxyalkane: coenzyme M transferase Methionine synthase (B12-independent) EC=2.1.1.14 ; Methyltransferase Plasmid

Pubmed 15599705

 

prodomImg

pubmed

1

310

S=288 I=31 E=3.25373e-26

Epoxyalkane:coenzyme M transferase

Pubmed 12949106

 

prodomImg

pubmed

9

307

S=266 I=27 E=1.28802e-23

5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase EC=2.1.1.14 ; Amino-acid biosynthesis Metal-binding Methionine Repeat Zinc

Pubmed 1339288,1379743

 

prodomImg

pubmed

14

307

S=264 I=28 E=2.60994e-23

5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase EC=2.1.1.14 ; Amino-acid biosynthesis Metal-binding Methionine Zinc

Pubmed 16088217

 

prodomImg

pubmed

11

310

S=250 I=27 E=1.29713e-21

5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase-like protein ; Amino-acid biosynthesis Metal-binding Methionine Zinc

Pubmed 10858335

 

prodomImg

pubmed

1

284

S=242 I=25 E=9.46908e-21

5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase EC=2.1.1.14 ; Amino-acid biosynthesis Metal-binding Methionine Repeat Zinc

Pubmed 19077236

 

prodomImg

pubmed

14

311

S=228 I=26 E=5.50578e-19

5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase EC=2.1.1.14 ; Amino-acid biosynthesis Metal-binding Methionine Repeat Zinc

Pubmed 16645985

 

prodomImg

pubmed

21

284

S=226 I=27 E=9.8745e-19

5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase EC=2.1.1.14 ; Amino-acid biosynthesis Metal-binding Methionine Repeat Zinc

Pubmed 17038625

 

prodomImg

sp

1

311

S=371 I=30 E=1.73941e-36

Probable methylcobalamin:homocysteine methyltransferase EC=2.1.1.- ; Amino-acid biosynthesis Metal-binding Methionine Zinc

 

prodomImg

sp

5

311

S=371 I=30 E=1.83283e-36

Probable methylcobalamin:homocysteine methyltransferase EC=2.1.1.- ; Amino-acid biosynthesis Metal-binding Methionine Zinc

 

prodomImg

sp

1

310

S=349 I=29 E=7.06813e-34

Probable methylcobalamin:homocysteine methyltransferase EC=2.1.1.- ; Amino-acid biosynthesis Metal-binding Methionine Zinc

 

prodomImg

sp

11

309

S=344 I=31 E=3.13904e-33

Probable methylcobalamin:homocysteine methyltransferase EC=2.1.1.- ; Amino-acid biosynthesis Metal-binding Methionine Zinc

 

prodomImg

sp

1

311

S=342 I=29 E=5.02653e-33

Probable methylcobalamin:homocysteine methyltransferase EC=2.1.1.- ; Amino-acid biosynthesis Metal-binding Methionine Zinc

 

prodomImg

Iprscan [G3DSA:3.20.20.210]

2

312

-

Iprscan IPR002629 [PF01717]

18

184

Methionine synthase, vitamin-B12 independent

PD004692

99

291

S=553 I=55 E=1.50033e-59

PD712689

1

98

S=397 I=80 E=1.1875e-40

PDA8S7R8

240

310

S=134 I=41 E=8.67105e-09

PD191524

69

184

S=130 I=33 E=2.99058e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one WfFg7kP3)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

46 hits
swiss-prot

Swiss-Prot ncbi-blastp

275 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSsScT9/XFF4834R_chr03100.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSsScT9/XFF4834R_chr03100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSsScT9/XFF4834R_chr03100.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSsScT9/XFF4834R_chr03100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.