Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr03000baeSXFF4834R_chr03000probable Signal transduction histidine-protein kinase BaeS

baeS XFF4834R_chr03000
XFF4834R_chr02990
XFF4834R_chr02990
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03010
XFF4834R_chr03010
ID baeS
AC XFF4834R_chr03000
LT XFF4834R_chr03000
OR XFF4834R_chr from 347551 to 348930 on strand -
DE probable Signal transduction histidine-protein kinase BaeS
IP Signal transduction histidine kinase-related protein, C-terminal; Signal transduction histidine kinase, homodimeric; Signal transduction histidine kinase, nitrate/nitrite-sensing
CL 3.1.2.4.3 Two-component regulatory systems (external signal) GO:0000155 GO:0000156
EC
GO InterPro
Biological Process: peptidyl-histidine phosphorylation (GO:0018106)
Biological Process: signal transduction (GO:0007165)
Biological Process: phosphorylation (GO:0016310)
Cellular Component: membrane (GO:0016020)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: signal transducer activity (GO:0004871)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: two-component sensor activity (GO:0000155)
Molecular Function: protein histidine kinase activity (GO:0004673)
transferring phosphorus-containing groups (GO:0016772)

Curated
PM
AN Member of the two-component regulatory system BaeS/BaeR. May activate BaeR by phosphorylation. low identity with BaeS of coli at the protein level (39%). much higher identity score at the nucleotide level. BaeR probably is XFF4834R_chr02990. For DE, I took description by Swissprot, however, they do not mention the word Sensor in their description, this gene most probably encodes the sensory protein of the 2 component system.
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120306)
MW 50235.2 Da
SQ 459 aa
 
........10........20........30........40........50
| | | | |
MKLGITAKLFLAILAACVAVLLINGIAVQAFVKRQFLDYLNEQGVERMQE
TLPRVRAEYARHGNWEFVRDNPDAWFVLMRPERGPGPPREAPPISDQTGA
VFRFALLDQDYTPVIGNPDVGRHDILRPVVVGGRTVGWMAMLPFQKALAA
ADARFYAAQQRAWWAIGGACLLVAAVLGWLLSRTLLRRLRGLTHATHLLA
AGDYATRIDAAARDELGQLARDFNLLAQALEHNERARRDFMADISHELRT
PLAVLRAELEALQDGIRPMTPNSLGSLHQQVGQLGKLIEDLYDVSLTDVG
ALAYRRAPVDLAVILATVLDGLRARFAAAQLQVQAQVDAGPLQVDGDERR
LQQLLGNLLENTLRYTDAGGTVQVRCVRRGAVLELVVEDSAPGVDADKRE
RLFERFYRTEASRNRTSGGSGLGLAICRNIAEAHGGSIHAEASALGGLRM
VLHLPGLVA
XFF4834R

XFF4834R_chr18250 lcl|XFF4834R_chr19530238_2087431_r3_XFF4834R-XFF4834R_chr18250

212

455

S=348 I=36 E=1.94948e-35

XFF4834R

XFF4834R_chr21590 lcl|XFF4834R_chr23530104_2506487_r2_XFF4834R-XFF4834R_chr21590

227

455

S=256 I=34 E=2.57563e-24

XFF4834R

XFF4834R_chr38410 lcl|XFF4834R_chr41490895_4436079_f1_XFF4834R-XFF4834R_chr38410

210

440

S=250 I=35 E=1.27003e-23

XFF4834R

XFF4834R_chr07370 lcl|XFF4834R_chr07780823_0854325_r1_XFF4834R-XFF4834R_chr07370

215

457

S=250 I=32 E=1.3151e-23

XFF4834R

XFF4834R_chr10450 lcl|phoR-XFF4834R_chr10450

234

454

S=243 I=34 E=8.7987e-23

sensory histidine kinase in two-component regulatory system with PhoB

XFF4834R

XFF4834R_chr35800 lcl|XFF4834R_chr39000203_4152314_r2_XFF4834R-XFF4834R_chr35800

231

455

S=241 I=31 E=1.56433e-22

XFF4834R

XFF4834R_chr16120 lcl|XFF4834R_chr17370806_1868315_f3_XFF4834R-XFF4834R_chr16120

231

455

S=226 I=30 E=1.00113e-20

XFF4834R

XFF4834R_chr04920 lcl|barA-XFF4834R_chr04920

217

457

S=222 I=30 E=2.82543e-20

hybrid sensory histidine kinase, in two-component regulatory system with UvrY

XFF4834R

XFF4834R_chr11650 lcl|XFF4834R_chr12140989_1302374_f3_XFF4834R-XFF4834R_chr11650

208

456

S=222 I=32 E=2.90031e-20

X.species

NP_640682.1 lcl|smeS-XAC0326

1

459

S=1809 I=80 E=0

two-component system sensor protein

X.species

YP_362066.1 lcl|XCV0335

1

459

S=1753 I=79 E=0

two-component system sensor protein

X.species

NP_643113.1 lcl|baeS-XAC2804

212

455

S=349 I=36 E=4.96077e-35

two-component system sensor protein

X.species

YP_364696.1 lcl|XCV2965

212

455

S=340 I=36 E=6.60909e-34

putative two-component system sensor histidine kinase

X.species

lcl|baeS-XALc_1553

203

455

S=294 I=31 E=2.58708e-28

probable two component system sensor protein

X.species

NP_642380.1 lcl|XAC2054-XAC2054

227

455

S=266 I=34 E=6.44621e-25

two-component system sensor protein

X.species

lcl|envZ-XALc_0859

215

455

S=265 I=32 E=7.6076e-25

probable two-component system sensor protein, osmolarity sensor protein envz.

X.species

YP_363946.1 lcl|XCV2215

227

455

S=264 I=34 E=9.62683e-25

two-component system sensor histidine kinase-response regulator hybrid protein

X.species

YP_362514.1 lcl|XCV0783

215

457

S=249 I=32 E=5.74585e-23

EnvZ family two-component response regulator

X.species

YP_365800.1 lcl|XCV4069

210

440

S=249 I=34 E=5.94977e-23

putative two-component system sensor protein

pubmed

1

455

S=950 I=47 E=2.83215e-106

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory

Pubmed 11709330,11796339

 

prodomImg

pubmed

1

455

S=943 I=47 E=2.2955e-105

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 17263848

 

prodomImg

pubmed

4

455

S=759 I=39 E=4.25906e-83

Signal transduction histidine-protein kinase baeS EC=2.7.13.3 ; ATP-binding Cell inner membrane Nucleotide-binding Phosphoprotein Transferase Tr

Pubmed 8282725

 

prodomImg

pubmed

203

455

S=337 I=29 E=6.20254e-32

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Plasmid Transferase Transmembrane Two-component regulatory

Pubmed 9037109,9049996

 

prodomImg

pubmed

215

455

S=316 I=35 E=1.99176e-29

Sensor protein EC=2.7.13.3 ; ATP-binding Kinase Membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component regulatory system

Pubmed 15118304

 

prodomImg

sp

4

455

S=759 I=39 E=2.89603e-83

Signal transduction histidine-protein kinase baeS EC=2.7.13.3 ; ATP-binding Cell inner membrane Nucleotide-binding Phosphoprotein Transferase Tr

 

prodomImg

sp

231

455

S=298 I=30 E=2.28134e-27

Sensor histidine kinase yycG EC=2.7.13.3 ; ATP-binding Cell membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component r

 

prodomImg

sp

234

446

S=290 I=33 E=1.88159e-26

Alkaline phosphatase synthesis sensor protein phoR EC=2.7.13.3 ; ATP-binding Cell membrane Kinase Nucleotide-binding Phosphate transport Phosph

 

prodomImg

sp

234

455

S=290 I=30 E=2.16326e-26

Sensor histidine kinase resE EC=2.7.13.3 ; ATP-binding Cell membrane Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-component r

 

prodomImg

sp

215

456

S=288 I=32 E=3.948e-26

Sensor kinase cusS EC=2.7.13.3 ; ATP-binding Cell inner membrane Copper Nucleotide-binding Phosphoprotein Transferase Transmembrane Two-compone

 

prodomImg

Iprscan IPR004358 [PR00344]

383

397

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

401

411

Signal transduction histidine kinase-related protein, C-terminal

Iprscan IPR004358 [PR00344]

418

436

Signal transduction histidine kinase-related protein, C-terminal

Iprscan [G3DSA:1.10.287.240]

226

296

-

Iprscan IPR003594 [G3DSA:3.30.565.10]

306

455

ATPase-like, ATP-binding domain

Iprscan [PTHR23283:SF23]

3

455

-

Iprscan [PTHR23283]

3

455

-

Iprscan IPR003594 [PF02518]

346

455

ATPase-like, ATP-binding domain

Iprscan IPR003660 [PF00672]

164

232

HAMP linker domain

Iprscan IPR003661 [PF00512]

237

295

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain

Iprscan IPR003660 [SM00304]

183

235

HAMP linker domain

Iprscan IPR003661 [SM00388]

236

300

Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain

Iprscan IPR003594 [SM00387]

346

458

ATPase-like, ATP-binding domain

Iprscan IPR005467 [PS50109]

243

458

Signal transduction histidine kinase, core

Iprscan IPR003660 [PS50885]

183

235

HAMP linker domain

Iprscan [seg]

11

23

-

Iprscan [seg]

80

93

-

Iprscan [seg]

147

162

-

Iprscan [seg]

177

202

-

Iprscan [seg]

322

339

-

Iprscan [SignalP-NN(euk)]

1

25

-

Iprscan [tmhmm]

10

32

-

Iprscan [tmhmm]

162

181

-

PDA7I7T6

229

301

S=294 I=85 E=3.85807e-28

PD419285

357

447

S=160 I=43 E=6.94762e-12

PD947749

240

295

S=158 I=52 E=1.152e-11

PDA6K932

234

277

S=148 I=61 E=1.87558e-10

PD105351

27

79

S=148 I=51 E=2.23288e-10

PDA6J958

414

447

S=146 I=85 E=3.63839e-10

PDA2Y2L2

354

381

S=141 I=100 E=1.63e-09

PDA0I2G5

342

442

S=138 I=34 E=3.13455e-09

PD593836

354

418

S=121 I=36 E=3.92554e-07

PDA2T3Z5

221

311

S=115 I=31 E=2.18696e-06

Iprscan IPR003594 [SSF55874]

289

455

ATPase-like, ATP-binding domain

Iprscan IPR009082 [SSF47384]

226

296

Signal transduction histidine kinase, homodimeric

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 0KL9Sy8Y)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

283 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

33 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

25 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBer_L5F/XFF4834R_chr03000.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBer_L5F/XFF4834R_chr03000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBer_L5F/XFF4834R_chr03000.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBer_L5F/XFF4834R_chr03000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.