Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr02300aceAXFF4834R_chr02300probable isocitrate lyase

aceA XFF4834R_chr02300
XFF4834R_chr02290
XFF4834R_chr02290
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr02310
XFF4834R_chr02310
ID aceA
AC XFF4834R_chr02300
LT XFF4834R_chr02300
OR XFF4834R_chr from 268969 to 270264 on strand +
DE probable isocitrate lyase
IP Isocitrate lyase/phosphorylmutase; Isocitrate lyase; Isocitrate lyase/phosphorylmutase, conserved site
CL 1.7.2 Glyoxylate bypass GO:0006097
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: carboxylic acid metabolic process (GO:0019752)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: isocitrate lyase activity (GO:0004451)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100423)
MW 46875.4 Da
SQ 431 aa
 
........10........20........30........40........50
| | | | |
MSTTLQSAEQLQQDWSNNPRWAGITRNYSAADVARLRGTVHVEHSLARMG
AEKLWDSLHATPFVNALGALTGNQAMQQIKAGLKAIYLSGWQVAADANLA
GQMYPDQSLYPADSVPAVVKRINNTLLRADQLHHAEGNDAIDFLQPIVAD
AEAGFGGVLNAFELMKAMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTR
EAIEKLNAARLAADVLGVPTVLIARTDAEAADLITSDVDANDQPFTTGER
TVEGFFKTRNGLDQAISRGLAYAPYADLIWCETGKPDLEFARAFAQAIHA
KFPGKLLAYNCSPSFNWKKNLDDATIAKFQTELASYGYKFQFITLAGFHA
LNHSMFHLAHGYARRQMSAFVELQQAEFEAAEMGFTAVKHQREVGTGYFD
AVTQAIQQGQSSTTALRGSTEEEQFQSDKAA
XFF4834R

XFF4834R_chr11310 lcl|prpB-XFF4834R_chr11310

36

228

S=162 I=33 E=4.9243e-13

2-methylisocitrate lyase

XFF4834R

XFF4834R_chr11310 lcl|prpB-XFF4834R_chr11310

36

228

S=162 I=33 E=4.9243e-13

2-methylisocitrate lyase

X.species

NP_640613.1 lcl|aceA-XAC0257

1

431

S=2289 I=99 E=0

isocitrate lyase

X.species

YP_361996.1 lcl|aceA-XCV0265

1

431

S=2249 I=97 E=0

isocitrate lyase

X.species

NP_635633.1 lcl|aceA-XCC0238

1

431

S=2160 I=94 E=0

isocitrate lyase

X.species

NP_636406.1 lcl|prpB-XCC1031

46

228

S=179 I=35 E=1.88817e-14

2-methylisocitrate lyase

X.species

YP_362887.1 lcl|prpB-XCV1156

57

228

S=162 I=34 E=2.11126e-12

2-methylisocitrate lyase

X.species

lcl|prpB-XALc_0638

45

228

S=162 I=35 E=2.20533e-12

probable methylisocitrate lyase protein

X.species

NP_641473.1 lcl|prpB-XAC1137

57

228

S=155 I=34 E=1.38812e-11

2-methylisocitrate lyase

pubmed

1

431

S=2160 I=94 E=0

Isocitrate lyase

Pubmed 16109965

 

prodomImg

pubmed

3

429

S=1807 I=77 E=0

Isocitrate lyase EC=4.1.3.1

Pubmed 14612238

 

prodomImg

pubmed

3

425

S=1582 I=69 E=0

Isocitrate lyase

Pubmed 10506180

 

prodomImg

pubmed

1

425

S=1571 I=69 E=0

Isocitrate lyase EC=4.1.3.1 ; Cytoplasm Glyoxylate bypass Phosphoprotein Tricarboxylic acid cycle

Pubmed 3050899,3060852

 

prodomImg

pubmed

1

425

S=1565 I=69 E=0

Isocitrate lyase EC=4.1.3.1 ; Cytoplasm Glyoxylate bypass Phosphoprotein Tricarboxylic acid cycle

Pubmed 9409817

 

prodomImg

pubmed

6

426

S=1512 I=68 E=1.89168e-174

Isocitrate lyase

Pubmed 11750062

 

prodomImg

pubmed

1

426

S=1512 I=65 E=2.0461e-174

Isocitrate lyase EC=4.1.3.1

Pubmed 11882714

 

prodomImg

pubmed

6

427

S=1496 I=64 E=1.80796e-172

Isocitrate lyase

Pubmed 15383716

 

prodomImg

pubmed

6

427

S=1496 I=64 E=1.80796e-172

Isocitrate lyase EC=4.1.3.1 ; Cytoplasm Glyoxylate bypass Tricarboxylic acid cycle

Pubmed 8206824

 

prodomImg

pubmed

1

426

S=1491 I=65 E=8.53469e-172

Isocitrate lyase EC=4.1.3.1 ; Cytoplasm Glyoxylate bypass Tricarboxylic acid cycle

Pubmed 8045408

 

prodomImg

sp

1

426

S=1620 I=71 E=0

Isocitrate lyase EC=4.1.3.1 ; Cytoplasm Glyoxylate bypass Tricarboxylic acid cycle

 

prodomImg

sp

1

425

S=1571 I=69 E=0

Isocitrate lyase EC=4.1.3.1 ; Cytoplasm Glyoxylate bypass Phosphoprotein Tricarboxylic acid cycle

 

prodomImg

sp

1

425

S=1571 I=69 E=0

Isocitrate lyase EC=4.1.3.1 ; Cytoplasm Glyoxylate bypass Tricarboxylic acid cycle

 

prodomImg

sp

1

425

S=1565 I=69 E=0

Isocitrate lyase EC=4.1.3.1 ; Cytoplasm Glyoxylate bypass Phosphoprotein Tricarboxylic acid cycle

 

prodomImg

sp

4

425

S=1557 I=68 E=5.75249e-180

Isocitrate lyase EC=4.1.3.1 ; Cytoplasm Glyoxylate bypass Tricarboxylic acid cycle

 

prodomImg

PD001857

154

310

S=323 I=53 E=1.13272e-31

PDA0J0M8

11

94

S=302 I=65 E=4.07394e-29

PD491180

362

426

S=238 I=74 E=2.52721e-21

PDA1F8Z5

95

137

S=189 I=81 E=1.90238e-15

PDA1F8Z6

337

375

S=173 I=82 E=2.09037e-13

PDA1F932

311

335

S=120 I=84 E=5.24103e-07

PDA1G316

261

282

S=120 I=100 E=5.37993e-07

PDA1F9N1

228

259

S=118 I=63 E=9.31808e-07

PDA563M4

260

282

S=110 I=83 E=8.24048e-06

PDA1G317

250

282

S=107 I=58 E=1.62667e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one LLLH6qTA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

96 hits
swiss-prot

Swiss-Prot ncbi-blastp

90 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2hHhlF/XFF4834R_chr02300.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2hHhlF/XFF4834R_chr02300.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2hHhlF/XFF4834R_chr02300.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2hHhlF/XFF4834R_chr02300.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.