Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr02290aceBXFF4834R_chr02290probable malate synthase A

aceB XFF4834R_chr02290
XFF4834R_chr02280
XFF4834R_chr02280
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr02300
XFF4834R_chr02300
ID aceB
AC XFF4834R_chr02290
LT XFF4834R_chr02290
OR XFF4834R_chr from 267185 to 268801 on strand +
DE probable malate synthase A
IP Malate synthase A; Malate synthase-like, core; Pyruvate/Phosphoenolpyruvate kinase, catalytic core
CL 1.7.2 Glyoxylate bypass GO:0006097
EC
GO InterPro
Biological Process: glyoxylate cycle (GO:0006097)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: malate synthase activity (GO:0004474)

Curated
PM
AN start changed to match XAC & XCC
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100423)
MW 59182.1 Da
SQ 538 aa
 
........10........20........30........40........50
| | | | |
MAATAFAPRPTDHATPGISLTTQIAGQAELLPAAALALLVSLHRAIEPGR
QQRLAQRRQRQAAFDAGQLPDFRSDTQAIRTGDWRVAPLPAALQDRRVEI
TGPTDPKMVINALNSGAKVFMADFEDSTAPTWRNLLAGQRTLAAAVRGDL
SFDAPNGKHYALRPEAERAVLIVRPRGWHLDEKHVLIDGQPLAGGLFDAA
LFAFHNGRTLLAKDRGPYLYLPKLQSMEEAALWDTALAHIEAMLGLPHGQ
IKVTVLIETLPAVFEMDEILYALRERIVGLNCGRWDYIFSYLKTFRAHRD
RVLPERGQVTMTQPFLKAYSELLIKTCHRRGAHAMGGMAAQIPISHDEAA
NEQAMARVRADKLREVTAGHDGTWVAHPALIPVAMKLFDEHMSTAHQQHV
LRNDVQVTRDLLIAPSPGNVTRAGFEGNVEVCVRYLAAWLDGNGCVPIHH
LMEDAATAEISRAQLWQWLHHGQHLDDGTAIDQHLLQATLRALPARLGTA
TALPGAARIDEAIALLQELSSADELADFLTVPAYRLID
X.species

NP_640612.1 lcl|mls-XAC0256

1

538

S=2413 I=87 E=0

malate synthase

X.species

YP_361995.1 lcl|XCV0264

1

538

S=2411 I=87 E=0

malate synthase

X.species

NP_635632.1 lcl|mls-XCC0237

1

538

S=2204 I=79 E=0

malate synthase

pubmed

1

538

S=2204 I=79 E=0

Malate synthase ; Acyltransferase

Pubmed 16109965

 

prodomImg

pubmed

69

537

S=1221 I=52 E=5.42615e-139

Bifunctional glyoxylate cycle protein EC=4.1.3.1 EC=2.3.3.9 ; bypass Lyase Multifunctional enzyme Transferase Tricarboxylic acid

Pubmed 7781887

 

prodomImg

pubmed

65

537

S=1210 I=51 E=1.08905e-137

Malate synthase A EC=2.3.3.9 ; Cytoplasm Glyoxylate bypass Transferase Tricarboxylic acid cycle

Pubmed 3050899,3060852

 

prodomImg

pubmed

65

537

S=1151 I=49 E=1.40639e-130

Malate synthase, glyoxysomal EC=2.3.3.9 ; Glyoxylate bypass Glyoxysome Transferase Tricarboxylic acid cycle

Pubmed 1832736

 

prodomImg

pubmed

67

534

S=1139 I=50 E=4.40327e-129

Malate synthase EC=2.3.3.9 ; Glyoxylate bypass Transferase Tricarboxylic acid cycle

Pubmed 16023073

 

prodomImg

pubmed

64

537

S=1133 I=48 E=2.56241e-128

Malate synthase, glyoxysomal EC=2.3.3.9 ; Glyoxylate bypass Glyoxysome Transferase Tricarboxylic acid cycle

Pubmed 2362818

 

prodomImg

pubmed

64

537

S=1132 I=49 E=2.86995e-128

Malate synthase EC=2.3.3.9 ; Glyoxylate bypass Transferase Tricarboxylic acid cycle

Pubmed 17701038

 

prodomImg

pubmed

64

537

S=1104 I=49 E=6.90594e-125

Malate synthase, glyoxysomal EC=2.3.3.9 ; Glyoxylate bypass Glyoxysome Transferase Tricarboxylic acid cycle

Pubmed 2103467

 

prodomImg

pubmed

64

537

S=1098 I=48 E=3.58816e-124

Malate synthase, glyoxysomal EC=2.3.3.9 ; Glyoxylate bypass Glyoxysome Transferase Tricarboxylic acid cycle

Pubmed 8547819

 

prodomImg

pubmed

64

534

S=1096 I=47 E=6.84027e-124

Malate synthase EC=2.3.3.9 ; Glyoxylate bypass Lyase Transferase Tricarboxylic acid cycle

Pubmed 14612238

 

prodomImg

sp

64

534

S=1317 I=55 E=8.1959e-151

Malate synthase EC=2.3.3.9 ; Cytoplasm Glyoxylate bypass Transferase Tricarboxylic acid cycle

 

prodomImg

sp

69

537

S=1221 I=52 E=3.73461e-139

Bifunctional glyoxylate cycle protein EC=4.1.3.1 EC=2.3.3.9 ; bypass Lyase Multifunctional enzyme Transferase Tricarboxylic acid

 

prodomImg

sp

65

537

S=1210 I=51 E=7.49555e-138

Malate synthase A EC=2.3.3.9 ; Cytoplasm Glyoxylate bypass Transferase Tricarboxylic acid cycle

 

prodomImg

sp

65

537

S=1161 I=47 E=7.13994e-132

Malate synthase EC=2.3.3.9 ; Glyoxylate bypass Transferase Tricarboxylic acid cycle

 

prodomImg

sp

65

537

S=1151 I=49 E=9.67965e-131

Malate synthase, glyoxysomal EC=2.3.3.9 ; Glyoxylate bypass Glyoxysome Transferase Tricarboxylic acid cycle

 

prodomImg

PDA1F8N7

205

384

S=592 I=61 E=3.68455e-64

PD003100

71

191

S=406 I=67 E=1.29192e-41

PD338679

385

537

S=211 I=37 E=4.25811e-18

PDA8O4Z3

75

191

S=119 I=30 E=7.567e-07

PDA3A2B2

1

24

S=112 I=92 E=4.5202e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one bXeuP6MH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

130 hits
swiss-prot

Swiss-Prot ncbi-blastp

35 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5VVZkG/XFF4834R_chr02290.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5VVZkG/XFF4834R_chr02290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5VVZkG/XFF4834R_chr02290.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5VVZkG/XFF4834R_chr02290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.