Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr02060XFF4834R_chr_0243117_0244019_f3_XFF4834R-XFF4834R_chr02060XFF4834R_chr02060putative hydrolase of the alpha/beta fold superfamily

XFF4834R_chr_0243117_0244019_f3_XFF4834R-XFF4834R_chr02060 XFF4834R_chr02060
XFF4834R_chr_0230
XFF4834R_chr_0230
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr02070
XFF4834R_chr02070
ID XFF4834R_chr_0243117_0244019_f3_XFF4834R-XFF4834R_chr02060
AC XFF4834R_chr02060
LT XFF4834R_chr02060
OR XFF4834R_chr from 243117 to 244019 on strand +
DE putative hydrolase of the alpha/beta fold superfamily
IP Alpha/beta hydrolase fold-1
CL 1 Metabolism GO:0008152
EC
GO InterPro


Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100419)
MW 34063.6 Da
SQ 300 aa
 
........10........20........30........40........50
| | | | |
MNYPGYPFTPKRLDVRPGVAMSYLDEGPRDGEVVVMLHGNPSWSYLWRHL
VSGLSDRYRCIVPDHIGMGLSDKPDDAPDAQPRYDYTLQSRVDDLDSLLR
HLGITGAVTLAVHDWGGMIGFGWALSHHAQVKRLVITNTAAFPLPAEKPM
PWQIAMGRHWRPGEWFIRTFNAFSSGASWLGVSRRMPSEVRRAYVAPYNN
WRNRISTIRFMQDIPLSPADKGWSLLDRSAQALPAFADRPAFIAWGLRDI
CFDKHFLAGFRKALPQAEVTAFDDANHYVLEDKHEVLVPAIRAFLERNPL
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr02770 lcl|XFF4834R_chr02910001_0323888_f3_XFF4834R-XFF4834R_chr02770

19

142

S=169 I=33 E=5.41828e-14

XFF4834R

XFF4834R_chr16030 lcl|XFF4834R_chr17240879_1851874_r3_XFF4834R-XFF4834R_chr16030

6

153

S=150 I=30 E=1.04022e-11

XFF4834R

XFF4834R_chr16470 lcl|XFF4834R_chr17720584_1903525_f2_XFF4834R-XFF4834R_chr16470

30

141

S=96 I=28 E=3.44735e-05

X.species

YP_361972.1 lcl|XCV0241

1

300

S=1548 I=97 E=1.38391e-180

alpha/beta family hydrolase

X.species

NP_640591.1 lcl|dhaA-XAC0235

1

300

S=1543 I=96 E=5.83286e-180

haloalkane dehalogenase

X.species

NP_635611.1 lcl|dhaA-XCC0216

1

300

S=1494 I=93 E=4.96076e-174

haloalkane dehalogenase

X.species

lcl|XALc_3072

1

300

S=1377 I=86 E=7.85131e-160

putative hydrolase of the alpha/beta fold superfamily protein

X.species

YP_362043.1 lcl|XCV0312

19

142

S=163 I=32 E=1.02807e-12

alpha/beta family hydrolase

X.species

NP_643346.2 lcl|XAC3037-XAC3037

6

153

S=147 I=30 E=8.25341e-11

hydrolase

X.species

YP_364905.1 lcl|XCV3174

6

153

S=147 I=30 E=8.39859e-11

alpha/beta family hydrolase

X.species

NP_638202.1 lcl|XCC2854

6

153

S=147 I=28 E=9.48893e-11

hydrolase

X.species

NP_638165.1 lcl|XCC2817

30

141

S=107 I=29 E=5.74875e-06

proline imino-peptidase

pubmed

6

296

S=779 I=52 E=9.86259e-86

Putative haloalkane dehalogenase

Pubmed 12055309

 

prodomImg

pubmed

5

295

S=298 I=31 E=1.45305e-27

Haloalkane dehalogenase EC=3.8.1.5 ; Detoxification Hydrolase

Pubmed 12089046

 

prodomImg

pubmed

5

295

S=298 I=31 E=1.45305e-27

Haloalkane dehalogenase EC=3.8.1.5 ; Detoxification Hydrolase Plasmid

Pubmed 9025284

 

prodomImg

pubmed

5

295

S=298 I=31 E=1.45305e-27

Haloalkane dehalogenase EC=3.8.1.5 ; Detoxification Hydrolase

Pubmed 9687453,10735862

 

prodomImg

pubmed

2

291

S=297 I=35 E=1.98882e-27

Haloalkane dehalogenase EC=3.8.1.5 ; Hydrolase

Pubmed 12147465

 

prodomImg

pubmed

5

287

S=297 I=31 E=2.22751e-27

Haloalkane dehalogenase EC=3.8.1.5 ; Hydrolase

Pubmed 10587433

 

prodomImg

pubmed

5

295

S=294 I=30 E=5.05535e-27

Haloalkane dehalogenase EC=3.8.1.5 ; Detoxification Hydrolase

Pubmed 10094681,10735862

 

prodomImg

pubmed

5

283

S=277 I=33 E=5.13569e-25

Haloalkane dehalogenase DmbB EC=3.8.1.5 ; Hydrolase

Pubmed 16269704

 

prodomImg

pubmed

6

298

S=242 I=29 E=1.0104e-20

CurN

Pubmed 15332855

 

prodomImg

pubmed

2

296

S=239 I=28 E=2.06533e-20

Haloalkane dehalogenase EC=3.8.1.5 ; Detoxification Hydrolase

Pubmed 2687254,4019411

 

prodomImg

sp

5

295

S=298 I=31 E=1.00116e-27

Haloalkane dehalogenase EC=3.8.1.5 ; Detoxification Hydrolase

 

prodomImg

Iprscan [G3DSA:3.40.50.1820]

1

297

-

Iprscan IPR000073 [PF00561]

58

293

Alpha/beta hydrolase fold-1

PD013287

2

297

S=328 I=33 E=2.76988e-32

PD860580

233

295

S=283 I=87 E=7.13473e-27

PD463600

150

227

S=253 I=61 E=3.66566e-23

PDA208K1

118

148

S=162 I=100 E=3.92863e-12

PD330619

16

140

S=128 I=32 E=5.04196e-08

PD011214

7

165

S=123 I=28 E=2.01676e-07

PD890090

21

116

S=117 I=37 E=9.43768e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one UA9csAmr)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

79 hits
swiss-prot

Swiss-Prot ncbi-blastp

58 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRsi5d0/XFF4834R_chr02060.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRsi5d0/XFF4834R_chr02060.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRsi5d0/XFF4834R_chr02060.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRsi5d0/XFF4834R_chr02060.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.