Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr01630XFF4834R_chr01780601_0201029_f3_XFF4834R-XFF4834R_chr01630XFF4834R_chr01630putative thioesterase

XFF4834R_chr01780601_0201029_f3_XFF4834R-XFF4834R_chr01630 XFF4834R_chr01630
XFF4834R_chr01620
XFF4834R_chr01620
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr01640
XFF4834R_chr01640
ID XFF4834R_chr01780601_0201029_f3_XFF4834R-XFF4834R_chr01630
AC XFF4834R_chr01630
LT XFF4834R_chr01630
OR XFF4834R_chr from 200601 to 201029 on strand +
DE putative thioesterase
IP Phenylacetic acid degradation-related protein
CL 1.1.5.1 Phenylacetic acid degradation GO:0010124
EC
GO InterPro


Curated
PM
AN PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria. Although orthologs of PaaI exist in archaea and eukaryotes, their function has not been determined. Sequence similarity between PaaI, E. coli medium chain acyl-CoA thioesterase II, and human thioesterase III suggests they all belong to the same thioesterase superfamily. The conserved fold present in these thioesterases is referred to as an asymmetric hot dog fold, similar to those of 4-hydroxybenzoyl-CoA thioesterase (4HBT) and the beta-hydroxydecanoyl-ACP dehydratases (FabA/FabZ).
CC COG: [Q] Secondary metabolites biosynthesis, transport and catabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120320)
MW 15012 Da
SQ 142 aa
 
........10........20........30........40........50
| | | | |
MTFREPVDLAALNAASRDTLIEHLGIVFTEAGDDWLRATMPVDARTRQPY
GLLHGGASVVLAETVGSSAGNLCVDMATQICVGLEINANHLRAATQGLVT
GTARAVHVGRSTHVWDITIENPAGKRVCVSRLTLAVVPRSNG
pubmed

3

140

S=390 I=52 E=2.8781e-39

Putative uncharacterized protein

Pubmed 9683477

 

prodomImg

pubmed

1

137

S=322 I=47 E=5.17234e-31

Esterase ybdB EC=3.1.-.- ; Hydrolase

Pubmed 2521621,2521622

 

prodomImg

pubmed

7

137

S=319 I=51 E=1.22617e-30

ComA-like protein

Pubmed 15077674

 

prodomImg

pubmed

16

141

S=304 I=48 E=7.71153e-29

YuxO protein

Pubmed 12007649

 

prodomImg

pubmed

17

139

S=299 I=49 E=3.03125e-28

ComA operon protein 2

Pubmed 2507523,9274030

 

prodomImg

pubmed

18

139

S=294 I=50 E=1.31146e-27

Putative uncharacterized protein yuxO

Pubmed 17827323

 

prodomImg

pubmed

16

128

S=274 I=48 E=3.35716e-25

ComAB protein

Pubmed 9765590

 

prodomImg

pubmed

15

141

S=158 I=31 E=4.62149e-11

4-chlorobenzoate thioesterase ; Plasmid

Pubmed 16597946

 

prodomImg

pubmed

15

141

S=158 I=31 E=4.62149e-11

4-chlorobenzoyl CoA thioesterase

Pubmed 17384944

 

prodomImg

pubmed

15

141

S=158 I=31 E=4.62149e-11

FcbC1 ; Plasmid

Pubmed 1476446,12907670

 

prodomImg

sp

3

138

S=406 I=57 E=2.52106e-41

UPF0152 protein PA1618

 

prodomImg

sp

3

136

S=384 I=57 E=1.25191e-38

UPF0152 protein VC_A0580

 

prodomImg

sp

1

136

S=360 I=51 E=8.50904e-36

UPF0152 protein PM0788

 

prodomImg

sp

1

137

S=352 I=51 E=8.42813e-35

Esterase ydiI EC=3.1.-.- ; Hydrolase

 

prodomImg

sp

1

137

S=344 I=49 E=8.13247e-34

UPF0152 protein HI1161

 

prodomImg

PD397580

48

141

S=136 I=34 E=5.92488e-09

PD963303

18

117

S=113 I=28 E=3.23834e-06

PD006741

17

71

S=104 I=43 E=4.42868e-05

PDA7W919

75

136

S=102 I=34 E=6.61383e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one rRs60u3A)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

11 hits
swiss-prot

Swiss-Prot ncbi-blastp

10 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmZbHmj/XFF4834R_chr01630.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmZbHmj/XFF4834R_chr01630.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmZbHmj/XFF4834R_chr01630.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmZbHmj/XFF4834R_chr01630.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.