Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr01280XFF4834R_chr01380707_0159845_r2_XFF4834R-XFF4834R_chr01280XFF4834R_chr01280putative TonB-dependent transporter

XFF4834R_chr01380707_0159845_r2_XFF4834R-XFF4834R_chr01280 XFF4834R_chr01280
XFF4834R_chr01270
XFF4834R_chr01270
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr01290
XFF4834R_chr01290
ID XFF4834R_chr01380707_0159845_r2_XFF4834R-XFF4834R_chr01280
AC XFF4834R_chr01280
LT XFF4834R_chr01280
OR XFF4834R_chr from 157707 to 159845 on strand -
DE putative TonB-dependent transporter
IP TonB-dependent receptor, beta-barrel; TonB-dependent receptor, plug
CL 4.1.B.14 The Outer Membrane Receptor (OMR) Family
EC
GO InterPro
Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Molecular Function: transporter activity (GO:0005215)
Molecular Function: receptor activity (GO:0004872)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: validated by darrasse (20121128)
MW 77314.9 Da
SQ 712 aa
 
........10........20........30........40........50
| | | | |
MSRLTFLAAACGLFATGATSPVLAADPAPPAATSIQRLPAVQVDAARVRG
VDDFDLPASFTVVAADDDNRRGAQMSELLDGIPGLVARDRQNYAQDTQLS
IRGFGARSTFGVRGVRLLVDGIPASMPDGQGQLSHFNVLGAERVEVLRGP
FSALYGNSSGGVLQLWSADGHPDDPWRLRATYGSNATVNVGAQLLGQQGA
VHYNVAANRFDTDGFRAHSRAKRDSVNAKLGFDLAEGSRLDLVLNHLDAP
DAQDPLGLTRAQFNADPAQATSVATQFNTRKSVRQSQAGAIFTQQLDNQT
LRLMAYGGQRSVEQFLAIPVAVQRNPLHSGGVIDLDSNYDGADARWAWQG
EALGRPLQLTVGANVDRQRQHRTGYENFVGDTLGVKGPLRRNQRDEVENV
DQFAQLWWQWSDRWAALLGVRHSEVRFESDDHYIVGRNPDDSGKRDYSAT
TPVAGIVFRADENLRFYASVGRGFETPTFNELGYRNDGGAGLALDLGAAT
SRNYEIGSKWRAQSGAAVEFAVFRADTDDELAVASNTNGRSTYRNIGATR
RQGAELSWQQPIGATQQLQLAYTFVDATVRDGYLTCASSGCATPTAAVAS
GSRLPGVPRQQLFARWQWQPAQWQFAAESVVSGATVVNDLATERAPGYAL
FNLEASRRWSTTQGALRTFARIDNVLDRQYVGSVIVNDGNGRYYEPGPDR
TYTVGLQWEFGG
XFF4834R

XFF4834R_chr06620 lcl|XFF4834R_chr06890788_0757172_f3_XFF4834R-XFF4834R_chr06620

447

710

S=187 I=29 E=9.1134e-16

XFF4834R

XFF4834R_chr14280 lcl|XFF4834R_chr15200205_1637394_f1_XFF4834R-XFF4834R_chr14280

34

167

S=122 I=36 E=7.09181e-08

XFF4834R

XFF4834R_chr13140 lcl|XFF4834R_chr13900187_1498214_f3_XFF4834R-XFF4834R_chr13140

77

286

S=122 I=27 E=7.67071e-08

XFF4834R

XFF4834R_chr06990 lcl|XFF4834R_chr07300773_0801818_r2_XFF4834R-XFF4834R_chr06990

59

243

S=118 I=26 E=1.80266e-07

XFF4834R

XFF4834R_chr14360 lcl|btuB-XFF4834R_chr14360

38

167

S=109 I=30 E=2.66651e-06

vitamin B12/cobalamin outer membrane transporter

XFF4834R

XFF4834R_chr36470 lcl|fhuA-XFF4834R_chr36470

392

710

S=104 I=25 E=1.08535e-05

ferrichrome outer membrane transporter

XFF4834R

XFF4834R_chr08580 lcl|XFF4834R_chr09150648_0996975_f1_XFF4834R-XFF4834R_chr08580

71

244

S=101 I=28 E=2.27732e-05

XFF4834R

XFF4834R_chr35170 lcl|fepA-XFF4834R_chr35170

61

165

S=101 I=33 E=2.61823e-05

iron-enterobactin outer membrane transporter

XFF4834R

XFF4834R_chr30610 lcl|XFF4834R_chr33270675_3521813_f3_XFF4834R-XFF4834R_chr30610

93

242

S=100 I=27 E=2.85675e-05

XFF4834R

XFF4834R_chr14550 lcl|fecA-XFF4834R_chr14550

425

710

S=100 I=22 E=3.06312e-05

KpLE2 phage-like element; ferric citrate outer membrane transporter

X.species

NP_640482.2 lcl|yncD-XAC0126

1

712

S=3355 I=91 E=0

iron transporter

X.species

YP_361833.1 lcl|XCV0102

1

712

S=3341 I=90 E=0

TonB-dependent outer membrane receptor

X.species

NP_635493.1 lcl|yncD-XCC0098

1

711

S=3067 I=84 E=0

iron transporter

X.species

NP_638820.1 lcl|fepA-XCC3474

447

710

S=180 I=30 E=2.37775e-14

TonB-dependent receptor

X.species

NP_641006.1 lcl|fepA-XAC0653

447

710

S=161 I=28 E=5.11273e-12

TonB-dependent receptor

X.species

lcl|XALc_3025

56

278

S=145 I=28 E=4.25022e-10

putative tonb-dependent outer membrane receptor protein

X.species

YP_362445.1 lcl|XCV0714

447

710

S=138 I=27 E=2.67525e-09

TonB-dependent outer membrane receptor

X.species

NP_643641.1 lcl|fecA-XAC3334

77

286

S=129 I=28 E=4.0977e-08

TonB-dependent receptor

X.species

NP_643509.1 lcl|fyuA-XAC3201

36

574

S=125 I=26 E=1.14643e-07

TonB-dependent receptor

X.species

NP_635788.1 lcl|fhuA-XCC0394

50

214

S=123 I=34 E=1.71209e-07

TonB-dependent receptor

pubmed

389

706

S=536 I=38 E=6.39825e-56

Putative uncharacterized protein ; Plasmid

Pubmed 18812424

 

prodomImg

pubmed

389

653

S=394 I=36 E=1.19209e-38

Putative uncharacterized protein ; Plasmid

Pubmed 11959547

 

prodomImg

pubmed

56

248

S=176 I=32 E=3.12432e-12

TonB-dependent receptor

Pubmed 18324396

 

prodomImg

pubmed

56

267

S=146 I=25 E=1.22504e-08

Iron(III) dicitrate TonB-dependent receptor

Pubmed 15838052,16980464

 

prodomImg

pubmed

411

680

S=134 I=24 E=3.80218e-07

Outer membrane receptor-like protein

Pubmed 10482517

 

prodomImg

pubmed

1

194

S=129 I=30 E=1.32283e-06

PdtK

Pubmed 14756880

 

prodomImg

pubmed

36

215

S=125 I=29 E=5.02155e-06

QbsI

Pubmed 15066027

 

prodomImg

pubmed

38

246

S=119 I=30 E=2.3295e-05

Putative receptor ; Signal

Pubmed 11234929,11525988

 

prodomImg

pubmed

34

169

S=117 I=32 E=3.89643e-05

Hemin receptor ; Cell membrane outer Ion transport Iron Signal TonB box

Pubmed 1425573,11705959

 

prodomImg

pubmed

51

186

S=115 I=30 E=6.40468e-05

Ferric siderophore receptor homolog

Pubmed 11807053

 

prodomImg

sp

51

710

S=1276 I=42 E=1.01448e-145

Probable tonB-dependent receptor yncD ; Cell membrane outer Signal box

 

prodomImg

sp

58

189

S=120 I=32 E=1.26807e-05

Vitamin B12 transporter btuB ; Calcium Cell membrane outer Ion Metal-binding Porin Signal TonB box Transmembrane

 

prodomImg

sp

58

189

S=120 I=32 E=1.29037e-05

Vitamin B12 transporter btuB ; Calcium Cell membrane outer Ion Metal-binding Porin Signal TonB box Transmembrane

 

prodomImg

sp

58

189

S=120 I=32 E=1.29037e-05

Vitamin B12 transporter btuB ; Calcium Cell membrane outer Ion Metal-binding Porin Signal TonB box Transmembrane

 

prodomImg

sp

58

189

S=120 I=32 E=1.37158e-05

Vitamin B12 transporter btuB ; Calcium Cell membrane outer Ion Metal-binding Porin Signal TonB box Transmembrane

 

prodomImg

PD895192

559

637

S=294 I=77 E=6.36466e-28

PD693869

41

98

S=276 I=95 E=9.91201e-26

PD141767

308

387

S=251 I=64 E=8.23298e-23

PD264614

203

298

S=221 I=48 E=3.77666e-19

PDA1H1G0

99

141

S=187 I=84 E=5.67052e-15

PDA34754

638

710

S=177 I=49 E=9.81318e-14

PD621019

7

40

S=111 I=71 E=9.0911e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ILPn4wXP)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

12 hits
swiss-prot

Swiss-Prot ncbi-blastp

12 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

10 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjgg6SZ/XFF4834R_chr01280.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjgg6SZ/XFF4834R_chr01280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjgg6SZ/XFF4834R_chr01280.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjgg6SZ/XFF4834R_chr01280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.