Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr01250aldBXFF4834R_chr01250probable Aldehyde dehydrogenase B

aldB XFF4834R_chr01250
XFF4834R_chr01240
XFF4834R_chr01240
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0142
XFF4834R_chr_0142
ID aldB
AC XFF4834R_chr01250
LT XFF4834R_chr01250
OR XFF4834R_chr from 154590 to 156122 on strand -
DE probable Aldehyde dehydrogenase B
IP Aldehyde dehydrogenase, conserved site
CL 1.7.23 Methylglyoxal metabolism GO:0009438
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: metabolic process (GO:0008152)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120320)
MW 55560.9 Da
SQ 510 aa
 
........10........20........30........40........50
| | | | |
MMNAQPATKPLNTDPQSIFKPRYDNFIGGTWVAPKGGQYFDNTTPINGKV
LTSIARSTAPDIEAALDAAHAAKNAWGKTSTTERSNILLKIADRIEQNLE
LLAYAETWDNGKPVRETLNADVPLCVDHFRYFAGAIRAQEGGISEIDSDT
IAYHFHEPLGVVGQIIPWNFPLLMACWKLAPALAAGNCVVMKPAEQTPAS
ILVLMELIGDLLPPGVLNVVNGFGLEAGKPLASNPRIAKIAFTGETTTGR
LIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAVEGFVLFAFN
QGEVCTCPSRALIQESIYDAFMEKALARVAAIKQGNPLDPNTMVGAQASS
EQLEKILSYIDIGKQEGAEVLIGGERNTLDGDLAEGFYVKPTVFKGHNKM
RVFQEEIFGPVVSVTTFKDEADALAIANDTLYGLGAGVWSRDASRLYRMG
RAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRENHKMMLDHYQQTKNLLV
SYSPKALGFF
XFF4834R

XFF4834R_chr07270 lcl|betB-XFF4834R_chr07270

21

500

S=820 I=41 E=1.08615e-92

betaine aldehyde dehydrogenase, NAD-dependent

XFF4834R

XFF4834R_chr08850 lcl|XFF4834R_chr09420449_1027918_r3_XFF4834R-XFF4834R_chr08850

26

501

S=569 I=35 E=2.83718e-62

XFF4834R

XFF4834R_chr24530 lcl|sad-XFF4834R_chr24530

40

501

S=454 I=30 E=2.82875e-48

predicted aldehyde dehydrogenase

XFF4834R

XFF4834R_chr31940 lcl|XFF4834R_chr34480466_3665971_r3_XFF4834R-XFF4834R_chr31940

21

502

S=389 I=28 E=2.01747e-40

XFF4834R

XFF4834R_chr37780 lcl|putA-XFF4834R_chr37780

76

481

S=368 I=32 E=7.00731e-38

fused DNA-binding transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

XFF4834R

XFF4834R_chr19380 lcl|XFF4834R_chr20740024_2218556_r2_XFF4834R-XFF4834R_chr19380

153

503

S=307 I=28 E=1.96611e-30

XFF4834R

XFF4834R_chr41130 lcl|XFF4834R_chr_4776385_4777803_r1_XFF4834R-XFF4834R_chr41130

76

466

S=271 I=27 E=3.83457e-26

XFF4834R

XFF4834R_chr25680 lcl|XFF4834R_chr28230536_2979152_r2_XFF4834R-XFF4834R_chr25680

98

322

S=129 I=29 E=7.27008e-09

XFF4834R

XFF4834R_chr12540 lcl|XFF4834R_chr13190488_1421068_f2_XFF4834R-XFF4834R_chr12540

76

322

S=116 I=27 E=2.25643e-07

XFF4834R

XFF4834R_chr07270 lcl|betB-XFF4834R_chr07270

21

500

S=820 I=41 E=1.08615e-92

betaine aldehyde dehydrogenase, NAD-dependent

X.species

YP_361836.1 lcl|XCV0105

2

510

S=2579 I=95 E=0

putative aldehyde dehydrogenase

X.species

NP_640485.2 lcl|aldA-XAC0129

1

510

S=2565 I=94 E=0

chloroacetaldehyde dehydrogenase

X.species

NP_635496.1 lcl|aldA-XCC0101

2

510

S=2545 I=93 E=0

chloroacetaldehyde dehydrogenase

X.species

lcl|XALc_2105

22

496

S=888 I=41 E=2.46887e-100

putative aldehyde dehydrogenase protein

X.species

YP_362506.1 lcl|betB-XCV0775

21

500

S=823 I=41 E=2.32743e-92

betaine aldehyde dehydrogenase

X.species

NP_641072.1 lcl|betB-XAC0719

21

500

S=812 I=40 E=4.17071e-91

betaine aldehyde dehydrogenase

X.species

NP_638749.1 lcl|betB-XCC3403

21

500

S=808 I=41 E=1.41358e-90

betaine aldehyde dehydrogenase

X.species

NP_641234.1 lcl|badH-XAC0882

26

501

S=573 I=35 E=4.59943e-62

aldehyde dehydrogenase

X.species

YP_362648.1 lcl|XCV0917

26

501

S=552 I=34 E=1.42634e-59

putative aldehyde dehydrogenase

X.species

lcl|XALc_3040

29

461

S=474 I=32 E=4.47485e-50

putative aldehyde dehydrogenase protein

pubmed

16

510

S=2205 I=82 E=0

Chloroacetaldehyde dehydrogenase ; Oxidoreductase Plasmid

Pubmed 9511738

 

prodomImg

pubmed

19

510

S=2148 I=80 E=0

Acetaldehyde dehydrogenase 2 EC=1.2.1.3 ; Acetoin catabolism NAD Oxidoreductase

Pubmed 1732222

 

prodomImg

pubmed

11

510

S=2129 I=78 E=0

NAD-dependent chloroacetaldehyde dehydrogenase ; Oxidoreductase

Pubmed 9511738

 

prodomImg

pubmed

9

510

S=1991 I=72 E=0

Aldehyde dehydrogenase ; Oxidoreductase

Pubmed 16944126

 

prodomImg

pubmed

19

510

S=1987 I=74 E=0

Alcohol dehydrogenase ; Oxidoreductase

Pubmed 14645271

 

prodomImg

pubmed

9

510

S=1981 I=72 E=0

Putative aldehyde dehydrogense ; Oxidoreductase

Pubmed 17675378

 

prodomImg

pubmed

19

510

S=1970 I=73 E=0

Aldehyde dehydrogenase 1 ; Oxidoreductase

Pubmed 10919810

 

prodomImg

pubmed

9

510

S=1967 I=72 E=0

EPTC-inducible aldehyde dehydrogenase EC=1.2.1.3 ; NAD Oxidoreductase

Pubmed 7836301

 

prodomImg

pubmed

19

510

S=1903 I=71 E=0

NAD+ dependent acetaldehyde dehydrogenase ; Oxidoreductase

Pubmed 10075429

 

prodomImg

pubmed

19

510

S=1895 I=70 E=0

Aldehyde dehydrogenase B EC=1.2.1.- ; Magnesium NADP Oxidoreductase

Pubmed 7768815,8041620

 

prodomImg

sp

19

510

S=2148 I=80 E=0

Acetaldehyde dehydrogenase 2 EC=1.2.1.3 ; Acetoin catabolism NAD Oxidoreductase

 

prodomImg

sp

19

510

S=2129 I=79 E=0

Aldehyde dehydrogenase EC=1.2.1.3 ; NAD Oxidoreductase

 

prodomImg

sp

1

510

S=2016 I=73 E=0

Aldehyde dehydrogenase EC=1.2.1.3 ; NAD Oxidoreductase

 

prodomImg

sp

19

510

S=1996 I=73 E=0

Probable aldehyde dehydrogenase EC=1.2.1.3 ; NAD Oxidoreductase

 

prodomImg

sp

9

510

S=1967 I=72 E=0

EPTC-inducible aldehyde dehydrogenase EC=1.2.1.3 ; NAD Oxidoreductase

 

prodomImg

PDA1S1O4

110

425

S=255 I=31 E=2.34864e-23

PDA1I787

267

319

S=246 I=79 E=3.56621e-22

PDA1F8I6

107

152

S=222 I=83 E=3.01422e-19

PD576555

157

504

S=214 I=25 E=2.21965e-18

PDA9F7Z1

212

498

S=161 I=26 E=6.62534e-12

PDA5V4J9

463

510

S=148 I=60 E=2.49112e-10

PDA1F9I7

76

106

S=148 I=94 E=2.53494e-10

PD250846

212

266

S=146 I=57 E=4.83246e-10

PDA6A8W1

153

175

S=139 I=100 E=2.62271e-09

PDA0J2C9

424

461

S=139 I=63 E=3.43663e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Z60R3z7a)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

9 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBu9iUlB/XFF4834R_chr01250.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBu9iUlB/XFF4834R_chr01250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBu9iUlB/XFF4834R_chr01250.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBu9iUlB/XFF4834R_chr01250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.