Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr01240XFF4834R_chr01360017_0154412_r2_XFF4834R-XFF4834R_chr01240XFF4834R_chr01240hypothetical protein

XFF4834R_chr01360017_0154412_r2_XFF4834R-XFF4834R_chr01240 XFF4834R_chr01240
XFF4834R_chr01230
XFF4834R_chr01230
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr01250
XFF4834R_chr01250
ID XFF4834R_chr01360017_0154412_r2_XFF4834R-XFF4834R_chr01240
AC XFF4834R_chr01240
LT XFF4834R_chr01240
OR XFF4834R_chr from 154017 to 154412 on strand -
DE hypothetical protein
IP Protein of unknown function DUF779
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by arlat (20100721)
MW 14314.1 Da
SQ 131 aa
 
........10........20........30........40........50
| | | | |
MQDSTTRVELPAQVTATLAALQLIDKLRAQHGDVLFHQSGGCCDGSSPMC
FAVGEFIVGDRDVLLGEIGGAPFYISAPQFEYWKHTQLIIDVVPGRGGMF
SLENGEGVRFLARSRLFDDDEFARLQHAGRA
Show or not Domain decomposition
 
X.species

YP_361837.1 lcl|XCV0106

1

131

S=596 I=87 E=1.09707e-65

hypothetical protein

X.species

NP_640486.1 lcl|XAC0130-XAC0130

1

131

S=590 I=87 E=4.58375e-65

hypothetical protein

X.species

NP_635497.1 lcl|XCC0102

4

131

S=527 I=79 E=2.28658e-57

hypothetical protein

pubmed

24

125

S=422 I=75 E=3.78769e-43

Putative uncharacterized protein ; Plasmid

Pubmed 9511738

 

prodomImg

pubmed

24

125

S=320 I=59 E=9.95659e-31

Putative uncharacterized protein

Pubmed 18997795

 

prodomImg

pubmed

26

121

S=307 I=56 E=3.37178e-29

Putative ORF1

Pubmed 7836301,8069783

 

prodomImg

Iprscan IPR008497 [PIRSF009151]

1

131

Protein of unknown function DUF779

Iprscan IPR008497 [PF05610]

22

116

Protein of unknown function DUF779

Iprscan [seg]

10

23

-

PD014835

24

71

S=213 I=81 E=2.1719e-18

PD019240

71

120

S=210 I=76 E=5.42529e-18

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nimEiZbG)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZovyo0/XFF4834R_chr01240.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZovyo0/XFF4834R_chr01240.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZovyo0/XFF4834R_chr01240.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZovyo0/XFF4834R_chr01240.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.