Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr00570XFF4834R_chr00570691_0069963_f1_acur-XFF4834R_chr00570XFF4834R_chr00570Conserved hypothetical protein

XFF4834R_chr00570691_0069963_f1_acur-XFF4834R_chr00570 XFF4834R_chr00570
XFF4834R_chr00560
XFF4834R_chr00560
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00580
XFF4834R_chr00580
ID XFF4834R_chr00570691_0069963_f1_acur-XFF4834R_chr00570
AC XFF4834R_chr00570
LT XFF4834R_chr00570
OR XFF4834R_chr from 69607 to 69963 on strand +
DE Conserved hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN Start modification, new protein shares homology with XAC0086 and XAUC_23730
CC COG: [S] Function unknown;
CC MODEL: acur
CC STATUS: curated by darrasse (20110811)
MW 13099 Da
SQ 118 aa
 
........10........20........30........40........50
| | | | |
MHCRSQRECPRRLSAYGRKHIGKTGLSRMVSARQYPRISVRARIQRSTLS
RADWPVSVDVELVDAVVQIDVDCLRGARSTAWLTHLVASRAAVLTASLPP
RKVQVPRSNADAAMCHPA
X.species

NP_640442.1 XAC0086-XAC0086

3

55

S=240 I=92 E=1.18577e-22

hypothetical protein

xanac

Iprscan [seg]

56

67

-

PD655135

3

55

S=240 I=92 E=1.40719e-21

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one wlr7TkAz)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6rKz1T/XFF4834R_chr00570.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6rKz1T/XFF4834R_chr00570.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6rKz1T/XFF4834R_chr00570.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6rKz1T/XFF4834R_chr00570.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.