Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr00460avrBs2XFF4834R_chr00460Avirulence protein AvrBs2, type III effector

avrBs2 XFF4834R_chr00460
XFF4834R_chr00450
XFF4834R_chr00450
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00470
XFF4834R_chr00470
ID avrBs2
AC XFF4834R_chr00460
LT XFF4834R_chr00460
OR XFF4834R_chr from 57157 to 59301 on strand +
DE Avirulence protein AvrBs2, type III effector
IP Glycerophosphoryl diester phosphodiesterase; PLC-like phosphodiesterase, TIM beta/alpha-barrel domain
CL 5.13 Virulence associated GO:0009405
EC
GO InterPro
Biological Process: glycerol metabolic process (GO:0006071)
Biological Process: lipid metabolic process (GO:0006629)
Molecular Function: glycerophosphodiester phosphodiesterase activity (GO:0008889)
Molecular Function: phosphoric diester hydrolase activity (GO:0008081)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20110712)
MW 78321.8 Da
SQ 714 aa
 
........10........20........30........40........50
| | | | |
MRIGPLQPSVAHTAAAALPAHTSAISPTQVPHMPGDTPPLRERPRRRAGS
VPPLVPLNGSAMTGRPALVALDSEFSEQRLAEVQARQITVQTLQTKLATH
LAQAGTAPKPDSIAARFAAGTLEPVYLDTAAFNAMSRGLPARARAAAGPV
LIDAQQGRIIFNLQRAFAPGDTFSDAALAALGKQLNLSGHGLATPDWLQP
AAGTPGRRKLQQAARYHGHEVPARDGGAGFFKANDHRLLEGKQALLRNHR
KSLVHDHYFEAPSTRAFGKDVMVHRGLFDNHAGIPENSLASIDHAYEQGY
RNLELDVEVSADGVPVLMHDFSIGRMAGDPQNRLVSQVPFAELREMPLVI
RNPSDGNYVKTDQTIAGVEQMLEHVLKKPEPMSVALDCKENTGEAVAMLL
MRRPDLRQAAAIKVYAKYYTGGFDQFLSNLYKHYQINPLHSQDAPRRAAL
DRLLAKINVVPVLSQGMLNDERLRGFFRSNEQGAAGLADTAMQWLDSWTK
MRPVIVEAVATDDSDAGMAMEMARTRMRQPDSAYAKAAYSVSYRYEDFSV
PRANHDKDYYVYRNFGEPQKLTNEAFGVKRTTAGAIRDDGESLLTDQPEA
ELLAILENRTLARGHTGNELDVPPETPIDINRDAEIVKQRTQQLQASSIP
AYPNHIAAVREGKQHDHTADMVNDPAAVRALDKRAKALGLLTDKYRGAPV
THYLNEQARQTETD
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr40440 lcl|XFF4834R_chr_4675416_4676516_r2_XFF4834R-XFF4834R_chr40440

271

325

S=148 I=48 E=4.57188e-11

XFF4834R

XFF4834R_chr33990 lcl|XFF4834R_chr36830635_3921582_r1_XFF4834R-XFF4834R_chr33990

268

372

S=111 I=35 E=1.55791e-06

XFF4834R

XFF4834R_chr40440 lcl|XFF4834R_chr_4675416_4676516_r2_XFF4834R-XFF4834R_chr40440

271

325

S=148 I=48 E=4.57188e-11

XFF4834R

XFF4834R_chr33990 lcl|XFF4834R_chr36830635_3921582_r1_XFF4834R-XFF4834R_chr33990

268

372

S=111 I=35 E=1.55791e-06

X.species

YP_361783.1 lcl|avrBs2-XCV0052

1

714

S=3330 I=90 E=0

avirulence protein AvrBs2

X.species

NP_640432.1 lcl|avrBs2-XAC0076

1

714

S=3275 I=89 E=0

avirulence protein

X.species

NP_635447.1 lcl|avrBs2-XCC0052

1

712

S=2625 I=72 E=0

avirulence protein

X.species

NP_639395.1 lcl|XCC4056

271

325

S=152 I=50 E=6.37279e-11

hypothetical protein

X.species

NP_644474.1 lcl|XAC4175-XAC4175

271

325

S=147 I=48 E=2.19793e-10

hypothetical protein

X.species

lcl|XALc_0096

271

325

S=128 I=41 E=5.52914e-08

hypothetical protein

X.species

YP_362897.1 lcl|XCV1166

285

372

S=111 I=36 E=5.91867e-06

putative glycerophosphodiester phosphodiesterase

X.species

NP_636417.1 lcl|glpQ-XCC1042

285

372

S=110 I=36 E=7.10789e-06

glycerophosphodiester phosphodiesterase

X.species

lcl|XALc_0551

259

327

S=105 I=36 E=3.02204e-05

hypothetical protein

pubmed

1

714

S=3330 I=90 E=0

Avirulence protein AvrBs2

Pubmed 8755898

 

prodomImg

pubmed

271

427

S=194 I=30 E=2.03038e-14

Agrocinopine synthase ; Plasmid

Pubmed 11043469

 

prodomImg

pubmed

271

422

S=169 I=28 E=2.28824e-11

Agrocinopine synthase

Pubmed 8324252

 

prodomImg

pubmed

301

422

S=162 I=31 E=1.57151e-10

Agrocinopine synthase ; Plasmid

Pubmed 10737141

 

prodomImg

pubmed

301

422

S=161 I=31 E=1.82259e-10

Tiorf172 protein ; Plasmid

Pubmed 10721727,9524202

 

prodomImg

pubmed

284

422

S=148 I=26 E=7.81039e-09

Agrocinopine synthase

Pubmed 7865795

 

prodomImg

pubmed

277

422

S=146 I=25 E=1.15629e-08

Tiorf180 protein ; Plasmid

Pubmed 10721727,9524202

 

prodomImg

pubmed

272

415

S=128 I=28 E=1.99935e-06

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Polymorphism Transmemb

Pubmed 10760272,10493829

 

prodomImg

pubmed

272

346

S=128 I=41 E=2.1815e-06

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Transmembrane

Pubmed 10760272

 

prodomImg

pubmed

272

346

S=127 I=41 E=2.50807e-06

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Transmembrane

Pubmed 10760272

 

prodomImg

sp

272

415

S=128 I=28 E=1.37721e-06

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Polymorphism Transmemb

 

prodomImg

sp

272

346

S=128 I=41 E=1.48963e-06

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Transmembrane

 

prodomImg

sp

272

346

S=128 I=41 E=1.50268e-06

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Transmembrane

 

prodomImg

sp

272

346

S=127 I=41 E=1.72763e-06

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Transmembrane

 

prodomImg

PD216138

345

714

S=1677 I=86 E=0

PD213174

1

273

S=987 I=76 E=6.61413e-112

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gmovSH4j)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

11 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBE1Sj7e/XFF4834R_chr00460.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBE1Sj7e/XFF4834R_chr00460.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBE1Sj7e/XFF4834R_chr00460.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBE1Sj7e/XFF4834R_chr00460.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.