Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr00330XFF4834R_chr_0037631_0037906_r3_acur-XFF4834R_chr00330XFF4834R_chr00330hypothetical protein

XFF4834R_chr_0037631_0037906_r3_acur-XFF4834R_chr00330 XFF4834R_chr00330
XFF4834R_chr00320
XFF4834R_chr00320
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00340
XFF4834R_chr00340
ID XFF4834R_chr_0037631_0037906_r3_acur-XFF4834R_chr00330
AC XFF4834R_chr00330
LT XFF4834R_chr00330
OR XFF4834R_chr from 37631 to 37906 on strand -
DE hypothetical protein
IP
CL 10 cryptic genes
EC
GO InterPro


Curated
PM
AN a deleter pas d'homologie avec BlastP blastN et tBlastN
CC COG: [S] Function unknown;
CC MODEL: acur
CC STATUS: curated by arlat (20100702)
MW 9507.9 Da
SQ 91 aa
 
........10........20........30........40........50
| | | | |
MVTLDLFGAGAIHVLDHRTGVSVVAPSSLRAHLLGAAQSLMDVGIHSPIL
FGLLFEHYGRFALSPNDLMTRAALSQTPSDLAAALVKEAAS
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one FRZHI1mJ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVGd6Rl/XFF4834R_chr00330.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVGd6Rl/XFF4834R_chr00330.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVGd6Rl/XFF4834R_chr00330.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVGd6Rl/XFF4834R_chr00330.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.