Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr00120exbD3XFF4834R_chr00120biopolymer transport ExbD protein

exbD3 XFF4834R_chr00120
XFF4834R_chr_0014
XFF4834R_chr_0014
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0016
XFF4834R_chr_0016
ID exbD3
AC XFF4834R_chr00120
LT XFF4834R_chr00120
OR XFF4834R_chr from 13830 to 14237 on strand +
DE biopolymer transport ExbD protein
IP Biopolymer transport protein ExbD/TolR
CL 4 Transport GO:0005215 GO:0006810
EC
GO InterPro
Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Molecular Function: transporter activity (GO:0005215)

Curated
PM
AN exbD2 was shown not to be required for ferric iron uptake in Xcc
CC COG: [U] Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20130521)
MW 14465.7 Da
SQ 135 aa
 
........10........20........30........40........50
| | | | |
MAFSTTGNRGPLAEINVTPLVDVMLVLLIIFIVTAPMVTRTIAVDLPQPS
SQVTTRLEPPAPIALRVDADGQLFWNASPVTLQQLQSRLIEQMQATAGNQ
PELRIAASADAEYAVMASVLAAAKNAQVQRIAFVQ
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr00110 lcl|XFF4834R_chr00100914_0013327_f2_XFF4834R-XFF4834R_chr00110

1

135

S=391 I=63 E=2.18245e-41

XFF4834R

XFF4834R_chr00100 lcl|exbD-XFF4834R_chr00100

1

134

S=245 I=41 E=1.0891e-23

membrane spanning protein in TonB-ExbB-ExbD complex

XFF4834R

XFF4834R_chr21920 lcl|XFF4834R_chr23890351_2538815_f3_XFF4834R-XFF4834R_chr21920

14

132

S=126 I=34 E=2.48597e-09

XFF4834R

XFF4834R_chr14850 lcl|XFF4834R_chr15930563_1707012_f1_XFF4834R-XFF4834R_chr14850

2

73

S=120 I=43 E=1.60623e-08

X.species

YP_361743.1 lcl|exbD3-XCV0012

1

135

S=625 I=93 E=3.36849e-69

biopolymer transport ExbD protein

X.species

NP_635406.1 lcl|exbD2-XCC0011

1

135

S=404 I=65 E=1.66838e-42

biopolymer transport ExbD2 protein

X.species

YP_361742.1 lcl|exbD2-XCV0011

1

135

S=391 I=63 E=7.59951e-41

biopolymer transport ExbD protein

X.species

NP_640367.1 lcl|exbD2-XAC0011

1

135

S=391 I=63 E=7.59951e-41

biopolymer transport ExbD2 protein

X.species

lcl|exbD2-XALc_0011

1

135

S=357 I=57 E=9.17567e-37

probable biopolymer transport exbd. transmembrane protein

X.species

NP_635405.1 lcl|exbD1-XCC0010

1

134

S=245 I=41 E=3.21341e-23

biopolymer transport ExbD1 protein

X.species

YP_361741.1 lcl|exbD1-XCV0010

1

134

S=245 I=41 E=3.79236e-23

biopolymer transport ExbD protein

X.species

NP_640366.1 lcl|exbD1-XAC0010

1

134

S=245 I=41 E=3.79236e-23

biopolymer transport ExbD1 protein

X.species

lcl|exbD1-XALc_0010

1

134

S=240 I=38 E=1.41473e-22

probable biopolymer transport exbd transmembrane protein

X.species

NP_638367.1 lcl|tolR-XCC3020

13

134

S=151 I=35 E=7.54815e-12

TolR protein

pubmed

1

135

S=404 I=65 E=5.02629e-41

Biopolymer transport protein exbD2 ; Cell inner membrane Transmembrane

Pubmed 9371459

 

prodomImg

pubmed

1

135

S=399 I=64 E=2.02809e-40

ExbD2 ; Protein transport Transmembrane

Pubmed 12646254

 

prodomImg

pubmed

1

134

S=264 I=41 E=4.95543e-24

ExbD ; Protein transport Transmembrane

Pubmed 10517598

 

prodomImg

pubmed

1

134

S=263 I=41 E=6.55013e-24

Biopolymer transport protein ExbD/TolR ExbD protein ; Transmembrane

Pubmed 10722583

 

prodomImg

pubmed

1

134

S=245 I=41 E=9.68093e-22

ExbD1 ; Protein transport Transmembrane

Pubmed 12646254

 

prodomImg

pubmed

1

134

S=245 I=41 E=9.68093e-22

Biopolymer transport protein exbD1 ; Cell inner membrane Transmembrane

Pubmed 9371459

 

prodomImg

pubmed

12

134

S=236 I=41 E=1.24556e-20

ExbD ; Protein transport Transmembrane

Pubmed 14532085

 

prodomImg

pubmed

1

134

S=221 I=39 E=8.39934e-19

Biopolymer transport protein exbD ; Cell inner membrane Transmembrane

Pubmed 9006036

 

prodomImg

pubmed

1

134

S=213 I=38 E=8.31947e-18

Biopolymer transport protein exbD ; Cell inner membrane Transmembrane

Pubmed 9140974

 

prodomImg

pubmed

1

134

S=204 I=35 E=9.55691e-17

Biopolymer transport protein ; Transmembrane

Pubmed 16309397

 

prodomImg

Iprscan IPR003400 [PF02472]

8

135

Biopolymer transport protein ExbD/TolR

Iprscan [tmhmm]

15

34

-

PDA1J7J0

84

135

S=156 I=63 E=1.81212e-11

PD007356

24

83

S=140 I=48 E=1.46752e-09

PDA6B4P7

1

25

S=129 I=100 E=3.59942e-08

PD689034

14

80

S=124 I=31 E=1.51707e-07

PD694913

15

82

S=106 I=32 E=2.05498e-05

PDA379Q2

12

58

S=103 I=47 E=5.60088e-05

PD973314

14

74

S=102 I=38 E=6.21862e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one UFtJ7qYq)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

32 hits
swiss-prot

Swiss-Prot ncbi-blastp

20 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7usOmw/XFF4834R_chr00120.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7usOmw/XFF4834R_chr00120.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7usOmw/XFF4834R_chr00120.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7usOmw/XFF4834R_chr00120.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.