Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr00110exbD2XFF4834R_chr00110biopolymer transport ExbD protein

exbD2 XFF4834R_chr00110
XFF4834R_chr00100
XFF4834R_chr00100
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0014
XFF4834R_chr_0014
ID exbD2
AC XFF4834R_chr00110
LT XFF4834R_chr00110
OR XFF4834R_chr from 12914 to 13327 on strand +
DE biopolymer transport ExbD protein
IP Biopolymer transport protein ExbD/TolR
CL 4 Transport GO:0005215 GO:0006810
EC
GO InterPro
Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Molecular Function: transporter activity (GO:0005215)

Curated
PM
AN exbD2 was shown not to be required for ferric iron uptake in Xcc
CC COG: [U] Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by szurek (20101121)
MW 15080.4 Da
SQ 137 aa
 
........10........20........30........40........50
| | | | |
MAFSTGGSRGPMADINVTPLVDVMLVLLIIFIVTAPIMTYPIAVDLPQRV
LNPPPQTTEPPPPIELRIDASNQVFWNNSPTPVDVLQQKMEEVVQADPTN
QPELRIDANPDAEYEVMAKVLAAAKNSQMKKIGFMQQ
XFF4834R

XFF4834R_chr00120 lcl|XFF4834R_chr00110830_0014237_f3_XFF4834R-XFF4834R_chr00120

1

136

S=391 I=60 E=2.24307e-41

XFF4834R

XFF4834R_chr00100 lcl|exbD-XFF4834R_chr00100

1

135

S=251 I=39 E=2.21145e-24

membrane spanning protein in TonB-ExbB-ExbD complex

XFF4834R

XFF4834R_chr14850 lcl|XFF4834R_chr15930563_1707012_f1_XFF4834R-XFF4834R_chr14850

2

47

S=116 I=54 E=4.08792e-08

X.species

YP_361742.1 lcl|exbD2-XCV0011

1

137

S=637 I=92 E=1.06168e-70

biopolymer transport ExbD protein

X.species

NP_640367.1 lcl|exbD2-XAC0011

1

137

S=637 I=92 E=1.06168e-70

biopolymer transport ExbD2 protein

X.species

NP_635406.1 lcl|exbD2-XCC0011

1

136

S=607 I=89 E=5.64828e-67

biopolymer transport ExbD2 protein

X.species

lcl|exbD2-XALc_0011

1

137

S=530 I=77 E=1.07805e-57

probable biopolymer transport exbd. transmembrane protein

X.species

YP_361743.1 lcl|exbD3-XCV0012

1

136

S=374 I=57 E=9.64046e-39

biopolymer transport ExbD protein

X.species

NP_635405.1 lcl|exbD1-XCC0010

1

135

S=251 I=39 E=7.07809e-24

biopolymer transport ExbD1 protein

X.species

YP_361741.1 lcl|exbD1-XCV0010

1

135

S=251 I=39 E=7.72292e-24

biopolymer transport ExbD protein

X.species

NP_640366.1 lcl|exbD1-XAC0010

1

135

S=251 I=39 E=7.72292e-24

biopolymer transport ExbD1 protein

X.species

lcl|exbD1-XALc_0010

1

135

S=237 I=38 E=2.92923e-22

probable biopolymer transport exbd transmembrane protein

X.species

lcl|tolR-XALc_2425

2

47

S=120 I=54 E=5.33006e-08

probable biopolymer transport tolr protein.

pubmed

1

136

S=607 I=89 E=1.72109e-65

Biopolymer transport protein exbD2 ; Cell inner membrane Transmembrane

Pubmed 9371459

 

prodomImg

pubmed

1

136

S=602 I=88 E=5.88439e-65

ExbD2 ; Protein transport Transmembrane

Pubmed 12646254

 

prodomImg

pubmed

1

135

S=251 I=39 E=2.15677e-22

ExbD1 ; Protein transport Transmembrane

Pubmed 12646254

 

prodomImg

pubmed

1

135

S=251 I=39 E=2.15677e-22

Biopolymer transport protein exbD1 ; Cell inner membrane Transmembrane

Pubmed 9371459

 

prodomImg

pubmed

1

135

S=233 I=37 E=3.44786e-20

Biopolymer transport protein ExbD/TolR ExbD protein ; Transmembrane

Pubmed 10722583

 

prodomImg

pubmed

1

135

S=231 I=36 E=5.33182e-20

ExbD ; Protein transport Transmembrane

Pubmed 10517598

 

prodomImg

pubmed

1

137

S=202 I=36 E=1.66655e-16

ExbD ; Protein transport Transmembrane

Pubmed 14532085

 

prodomImg

pubmed

1

137

S=194 I=37 E=1.65071e-15

ExbD1 ; Protein transport Transmembrane

Pubmed 16457898,18671744

 

prodomImg

pubmed

1

137

S=188 I=34 E=9.35803e-15

Biopolymer transport protein exbD ; Cell inner membrane Transmembrane

Pubmed 9006036

 

prodomImg

pubmed

7

137

S=184 I=35 E=2.75874e-14

Biopolymer transport protein ; Transmembrane

Pubmed 16309397

 

prodomImg

Iprscan IPR003400 [PF02472]

8

137

Biopolymer transport protein ExbD/TolR

Iprscan [seg]

53

63

-

Iprscan [tmhmm]

20

42

-

PDA1J7J0

86

136

S=248 I=94 E=1.24866e-22

PDA2W8V7

49

85

S=123 I=70 E=1.90691e-07

PDA286N4

49

83

S=114 I=69 E=2.43214e-06

PDA1H5U6

1

25

S=110 I=88 E=7.62116e-06

PDA6B4P7

1

25

S=109 I=84 E=9.23261e-06

PDA6B525

49

84

S=107 I=64 E=1.85458e-05

PD973314

14

79

S=104 I=33 E=3.79086e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gPJ2wNaD)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

26 hits
swiss-prot

Swiss-Prot ncbi-blastp

16 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvyetoB/XFF4834R_chr00110.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvyetoB/XFF4834R_chr00110.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvyetoB/XFF4834R_chr00110.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBvyetoB/XFF4834R_chr00110.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.