Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr00090ExbB1XFF4834R_chr00090biopolymer transport ExbB protein

ExbB1 XFF4834R_chr00090
XFF4834R_chr00080
XFF4834R_chr00080
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00100
XFF4834R_chr00100
ID ExbB1
AC XFF4834R_chr00090
LT XFF4834R_chr00090
OR XFF4834R_chr from 11680 to 12441 on strand +
DE biopolymer transport ExbB protein
IP MotA/TolQ/ExbB proton channel
CL 5.5.7 Fe aquisition GO:0006826
EC
GO InterPro
Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Molecular Function: protein transporter activity (GO:0008565)

Curated
PM
AN test sebastien
CC COG: [U] Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by szurek (20101121)
MW 26696.1 Da
SQ 253 aa
 
........10........20........30........40........50
| | | | |
MLQEFFIAAAAGGSNPSAALSQMGFEHLITEMTSSPGDFAVSWVVLITLI
AMSAASWYWTVINIFRATRLKSAADRVTTAFWDAPNAQDAIRAMEEQPAS
EPFSKIALDAAQAAAHHQRAEGSTGGLGESLSRSEFVDRALRQAVTREST
KLQSGMTLLATVGATAPFVGLLGTVWGIYGALIKIGATGSASIDAVAGPV
GEALIMTAIGLFVAIPAVFAFNFFSKVNSSVIAKFDTFAHDLHDFFATGS
RVR
XFF4834R

XFF4834R_chr14840 lcl|tolQ-XFF4834R_chr14840

138

241

S=228 I=48 E=2.93482e-21

membrane spanning protein in TolA-TolQ-TolR complex

XFF4834R

XFF4834R_chr21910 lcl|XFF4834R_chr23880718_2538347_f3_XFF4834R-XFF4834R_chr21910

151

239

S=138 I=31 E=2.08788e-10

X.species

YP_361740.1 lcl|exbB1-XCV0009

1

253

S=1075 I=85 E=2.26702e-123

biopolymer transport ExbB protein

X.species

NP_640365.1 lcl|exbB-XAC0009

1

253

S=1075 I=85 E=2.26702e-123

biopolymer transport ExbB protein

X.species

NP_635404.1 lcl|exbB-XCC0009

1

253

S=1069 I=85 E=1.17789e-122

biopolymer transport ExbB protein

X.species

lcl|exbB-XALc_0009

1

253

S=1031 I=81 E=5.16844e-118

probable biopolymer transport protein

X.species

NP_638368.1 lcl|tolQ-XCC3021

138

241

S=229 I=48 E=8.47402e-21

TolQ protein

X.species

YP_365006.1 lcl|tolQ-XCV3275

138

241

S=228 I=48 E=1.06301e-20

biopolymer transport TolQ protein

X.species

NP_643453.1 lcl|tolQ-XAC3145

138

241

S=228 I=48 E=1.09118e-20

TolQ protein

X.species

lcl|tolQ-XALc_2426

139

241

S=207 I=44 E=4.20805e-18

probable biopolymer transport tolq transmembrane protein

X.species

YP_363983.1 lcl|exbB2-XCV2252

151

239

S=138 I=31 E=8.92494e-10

biopolymer transport ExbB protein

X.species

NP_642406.1 lcl|exbB-XAC2085

151

239

S=137 I=31 E=1.29845e-09

biopolymer transport protein

pubmed

1

253

S=1069 I=85 E=4.29297e-121

ExbB ; Protein transport Transmembrane

Pubmed 12646254

 

prodomImg

pubmed

1

253

S=1069 I=85 E=4.29297e-121

Biopolymer transport protein exbB ; Cell inner membrane Transmembrane

Pubmed 9371459

 

prodomImg

pubmed

23

252

S=408 I=38 E=5.6418e-41

MotA/TolQ/ExbB proton channel family protein ExbB protein ; transport Transmembrane

Pubmed 10722583

 

prodomImg

pubmed

23

252

S=403 I=38 E=2.37789e-40

ExbB ; Protein transport Transmembrane

Pubmed 10517598

 

prodomImg

pubmed

37

250

S=384 I=42 E=4.48622e-38

ExbB ; Protein transport Transmembrane

Pubmed 14532085

 

prodomImg

pubmed

37

249

S=355 I=38 E=1.74376e-34

ExbB ; Protein transport Transmembrane

Pubmed 16457898,18671744

 

prodomImg

pubmed

45

243

S=328 I=37 E=3.43357e-31

Biopolymer transport protein exbB ; Cell inner membrane Transmembrane

Pubmed 9140974

 

prodomImg

pubmed

45

243

S=320 I=36 E=2.78296e-30

Biopolymer transport protein exbB ; Cell inner membrane Transmembrane

Pubmed 9006036

 

prodomImg

pubmed

137

245

S=300 I=50 E=7.06217e-28

Transport protein ExbB ExbB ; Transmembrane

Pubmed 10689178

 

prodomImg

pubmed

136

242

S=280 I=48 E=2.15222e-25

TolQ protein ; transport Transmembrane

Pubmed 10678921

 

prodomImg

Iprscan IPR002898 [PF01618]

100

240

MotA/TolQ/ExbB proton channel

Iprscan [seg]

8

19

-

Iprscan [seg]

110

120

-

Iprscan [seg]

121

135

-

Iprscan [tmhmm]

39

61

-

Iprscan [tmhmm]

161

183

-

Iprscan [tmhmm]

203

225

-

PD003317

146

253

S=258 I=48 E=7.69901e-24

PDA1K115

224

253

S=149 I=93 E=1.50338e-10

PD873528

32

107

S=134 I=37 E=9.13085e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one qZv6BMN0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

48 hits
swiss-prot

Swiss-Prot ncbi-blastp

25 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBquffbz/XFF4834R_chr00090.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBquffbz/XFF4834R_chr00090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBquffbz/XFF4834R_chr00090.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBquffbz/XFF4834R_chr00090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.