Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr00080XFF4834R_chr00080925_0011593_f2_XFF4834R-XFF4834R_chr00080XFF4834R_chr00080TonB protein

XFF4834R_chr00080925_0011593_f2_XFF4834R-XFF4834R_chr00080 XFF4834R_chr00080
XFF4834R_chr00070
XFF4834R_chr00070
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00090
XFF4834R_chr00090
ID XFF4834R_chr00080925_0011593_f2_XFF4834R-XFF4834R_chr00080
AC XFF4834R_chr00080
LT XFF4834R_chr00080
OR XFF4834R_chr from 10925 to 11593 on strand +
DE TonB protein
IP Gram-negative bacterial tonB protein
CL 4.2.C.1 TonB Family of Auxiliary Proteins for Energization of OMR-mediated Transport
EC
GO InterPro
Biological Process: iron ion transport (GO:0006826)
Biological Process: protein transport (GO:0015031)
Cellular Component: outer membrane-bounded periplasmic space (GO:0030288)
Cellular Component: membrane (GO:0016020)
Molecular Function: protein transporter activity (GO:0008565)
Molecular Function: iron ion transmembrane transporter activity (GO:0005381)

Curated
PM
AN
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100818)
MW 23489.8 Da
SQ 222 aa
 
........10........20........30........40........50
| | | | |
MTEQLVIHRHDYDAGNQGLSWARIIGIAFVIALHLTALMMLLIPAVAPKA
PAEKERTTMVTLVDAPPPPPPPPPPPPEDKPPPPVKNLSPPKPSPVPPPP
EAPVVDVPEPRPSDIVTPPSPPSPPAPPSDIGASVDISSKNMNPPKYPPA
AFRAGVQGEVILIVDVDASGNVTNVSVEKSSRNRDLDRAAMDAARKWKFN
ASTVNGQKAAGRVRVPVNFALN
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr22140 lcl|XFF4834R_chr24110978_2562400_r3_XFF4834R-XFF4834R_chr22140

133

219

S=134 I=36 E=6.43943e-10

XFF4834R

XFF4834R_chr12880 lcl|XFF4834R_chr_1467687_1468991_f3_XFF4834R-XFF4834R_chr12880

140

222

S=128 I=31 E=3.37507e-09

XFF4834R

XFF4834R_chr18580 lcl|XFF4834R_chr19920044_2123721_r1_XFF4834R-XFF4834R_chr18580

145

222

S=122 I=39 E=1.78446e-08

XFF4834R

XFF4834R_chr28570 lcl|XFF4834R_chr31110171_3289749_f1_XFF4834R-XFF4834R_chr28570

145

219

S=99 I=32 E=9.50144e-06

XFF4834R

XFF4834R_chr28560 lcl|XFF4834R_chr31080263_3288925_f2_XFF4834R-XFF4834R_chr28560

141

219

S=96 I=38 E=2.70502e-05

X.species

YP_361739.1 lcl|tonB1-XCV0008

130

222

S=397 I=85 E=3.1412e-41

energy transducer TonB protein

X.species

YP_361739.1 lcl|tonB1-XCV0008

1

65

S=271 I=82 E=5.61226e-26

energy transducer TonB protein

X.species

NP_640364.1 lcl|tonB-XAC0008

130

222

S=397 I=85 E=3.1412e-41

TonB protein

X.species

NP_640364.1 lcl|tonB-XAC0008

1

65

S=271 I=82 E=5.61226e-26

TonB protein

X.species

NP_635403.1 lcl|tonB-XCC0008

130

222

S=393 I=84 E=1.01923e-40

TonB protein

X.species

NP_635403.1 lcl|tonB-XCC0008

1

65

S=271 I=82 E=6.12355e-26

TonB protein

X.species

lcl|XALc_0008

130

222

S=364 I=76 E=2.89445e-37

putative energy transducer tonb protein

X.species

lcl|XALc_0008

1

64

S=133 I=62 E=3.13942e-09

putative energy transducer tonb protein

X.species

lcl|blaR1-XALc_2316

132

219

S=149 I=38 E=3.52208e-11

putative blar1 antirepressor protein

X.species

NP_643669.1 lcl|XAC3362-XAC3362

140

222

S=133 I=31 E=2.54667e-09

TonB-like protein

X.species

NP_642432.1 lcl|XAC2115-XAC2115

133

219

S=132 I=34 E=4.07798e-09

hypothetical protein

X.species

YP_364158.1 lcl|XCV2427

133

219

S=127 I=34 E=1.57526e-08

putative secreted protein

X.species

lcl|tonB3-XALc_1701

141

219

S=125 I=33 E=2.47886e-08

putative tonb_protein

X.species

YP_365210.1 lcl|blaR1-XCV3479

141

222

S=125 I=32 E=2.54455e-08

putative BlaR1 antirepressor (fragment)

X.species

NP_637446.1 lcl|XCC2081

133

219

S=123 I=31 E=4.97934e-08

hypothetical protein

X.species

NP_643083.1 lcl|XAC2774-XAC2774

145

222

S=121 I=39 E=8.54939e-08

TonB-like protein

X.species

YP_364661.1 lcl|tonB4-XCV2930

145

222

S=120 I=39 E=1.2117e-07

TonB-like protein

X.species

NP_637960.1 lcl|tonB-XCC2612

145

222

S=120 I=39 E=1.24381e-07

TonB like protein

X.species

NP_638551.1 lcl|XCC3205

137

222

S=115 I=29 E=4.68062e-07

TonB-like protein

X.species

NP_641983.1 lcl|XAC1651-XAC1651

145

219

S=106 I=34 E=5.86665e-06

TonB-like protein

X.species

NP_641984.1 lcl|XAC1652-XAC1652

141

219

S=103 I=38 E=1.3431e-05

hypothetical protein

X.species

YP_363423.1 lcl|tonB2-XCV1692

145

219

S=98 I=31 E=4.96688e-05

TonB-like protein

X.species

NP_636964.1 lcl|XCC1593

141

219

S=96 I=35 E=8.30783e-05

hypothetical protein

pubmed

130

222

S=393 I=84 E=4.00665e-39

TonB

Pubmed 12646254

 

prodomImg

pubmed

1

65

S=271 I=82 E=2.40719e-24

TonB

Pubmed 12646254

 

prodomImg

pubmed

130

222

S=393 I=84 E=4.00665e-39

Protein tonB ; Cell inner membrane transport Repeat Signal-anchor Transmembrane

Pubmed 9371459

 

prodomImg

pubmed

1

65

S=271 I=82 E=2.40719e-24

Protein tonB ; Cell inner membrane transport Repeat Signal-anchor Transmembrane

Pubmed 9371459

 

prodomImg

pubmed

143

222

S=120 I=36 E=4.80495e-06

Protein tonB2 ; Cell inner membrane transport Transmembrane

Pubmed 10689178

 

prodomImg

sp

130

222

S=393 I=84 E=2.73763e-39

Protein tonB ; Cell inner membrane transport Repeat Signal-anchor Transmembrane

 

prodomImg

sp

1

65

S=271 I=82 E=1.64476e-24

Protein tonB ; Cell inner membrane transport Repeat Signal-anchor Transmembrane

 

prodomImg

sp

130

222

S=393 I=84 E=2.73763e-39

Protein tonB ; Cell inner membrane transport Repeat Signal-anchor Transmembrane

 

prodomImg

sp

1

65

S=271 I=82 E=1.64476e-24

Protein tonB ; Cell inner membrane transport Repeat Signal-anchor Transmembrane

 

prodomImg

sp

143

222

S=120 I=36 E=3.28308e-06

Protein tonB2 ; Cell inner membrane transport Transmembrane

 

prodomImg

Iprscan IPR003538 [PR01374]

68

78

Gram-negative bacterial tonB protein

Iprscan IPR003538 [PR01374]

139

160

Gram-negative bacterial tonB protein

Iprscan IPR003538 [PR01374]

160

178

Gram-negative bacterial tonB protein

Iprscan IPR006260 [PF03544]

144

221

TonB, C-terminal

Iprscan IPR006260 [TIGR01352]

145

222

TonB, C-terminal

Iprscan [seg]

44

55

-

Iprscan [seg]

66

129

-

Iprscan [seg]

182

195

-

Iprscan [SignalP-NN(euk)]

1

38

-

Iprscan [tmhmm]

21

43

-

PD054380

1

65

S=262 I=82 E=2.60058e-24

PDA1K2O3

130

174

S=223 I=96 E=1.68935e-19

Iprscan [SSF74653]

91

222

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one qbWFcuT1)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzLolLs/XFF4834R_chr00080.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzLolLs/XFF4834R_chr00080.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzLolLs/XFF4834R_chr00080.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzLolLs/XFF4834R_chr00080.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.