Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr00070XFF4834R_chr00070578_0010771_f2_XFF4834R-XFF4834R_chr00070XFF4834R_chr00070hypothetical protein

XFF4834R_chr00070578_0010771_f2_XFF4834R-XFF4834R_chr00070 XFF4834R_chr00070
XFF4834R_chr00060
XFF4834R_chr00060
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00080
XFF4834R_chr00080
ID XFF4834R_chr00070578_0010771_f2_XFF4834R-XFF4834R_chr00070
AC XFF4834R_chr00070
LT XFF4834R_chr00070
OR XFF4834R_chr from 9578 to 10771 on strand +
DE hypothetical protein
IP Tetratricopeptide region; Chs5p-Arf1p binding
CL 10.2 Conserved hypothetical protein
EC
GO InterPro
Molecular Function: binding (GO:0005488)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: acur
CC STATUS: curated by pieretti (20100412)
MW 43413.7 Da
SQ 397 aa
 
........10........20........30........40........50
| | | | |
MKLLNRKQALLSLFIAASLGGAVVTDAVAQSDRSSDRSSRKSKSGKAEEL
YPQSTRQAPTIKPSSKLSSKLQKLIETFNKGEDYQGVRTQADEILANGAA
NDADKALAAQLAAQAAYNLDDTAGAKKYLQQAIGLNALDNNGHFQSMLML
AQLQMQDDQQAEGLATLDKYLEESKSQRPEDLILKGQALYQTERYKEAIP
VLKQAIAASPEPKDSWNQLLMASYAEAGQTGEAVAAAEALAAKTPNDKKA
QLNLANMYMQADQMDKAAGVMDKLRASGQLTEEKEYKQLYSIYANTENKE
KDVIAVINEGMQKGILKPDYQTYLALAQSYYYSDDVPKAIENWQKAAPLS
KDGETYLNLAKVLHSEGRIPEAKQAAQQAIAKGVKKPEDAKKIINLK
X.species

NP_640363.1 lcl|XAC0007-XAC0007

1

397

S=1446 I=74 E=4.75356e-168

hypothetical protein

X.species

YP_361738.1 lcl|XCV0007

1

397

S=1431 I=74 E=3.26193e-166

putative secreted protein

X.species

NP_635402.1 lcl|XCC0007

1

397

S=1342 I=70 E=1.91555e-155

hypothetical protein

X.species

lcl|XALc_0007

1

397

S=1135 I=62 E=2.3533e-130

conserved hypothetical protein.

pubmed

1

397

S=1342 I=70 E=7.34817e-154

Putative uncharacterized protein Putative uncharacterized protein orf398

Pubmed 12646254

 

prodomImg

Iprscan IPR011990 [G3DSA:1.25.40.10]

113

382

Tetratricopeptide-like helical

Iprscan [PTHR10483:SF8]

166

378

-

Iprscan [PTHR10483]

166

378

-

Iprscan IPR015374 [PF09295]

145

252

Chs5p-Arf1p binding

Iprscan IPR019734 [SM00028]

106

139

Tetratricopeptide repeat

Iprscan IPR019734 [SM00028]

179

212

Tetratricopeptide repeat

Iprscan IPR019734 [SM00028]

320

353

Tetratricopeptide repeat

Iprscan IPR019734 [SM00028]

354

386

Tetratricopeptide repeat

Iprscan IPR019734 [PS50005]

179

212

Tetratricopeptide repeat

Iprscan IPR019734 [PS50005]

320

353

Tetratricopeptide repeat

Iprscan IPR013026 [PS50293]

106

353

Tetratricopeptide repeat-containing

Iprscan [seg]

31

44

-

Iprscan [seg]

62

74

-

Iprscan [seg]

95

121

-

Iprscan [seg]

147

161

-

Iprscan [seg]

225

242

-

Iprscan [seg]

372

386

-

Iprscan [SignalP-NN(euk)]

1

29

-

PD789587

213

371

S=672 I=82 E=5.55443e-74

PD322356

1

94

S=306 I=68 E=1.20455e-29

Iprscan [SSF48452]

104

391

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one j1D3y94T)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

19 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtQQQxJ/XFF4834R_chr00070.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtQQQxJ/XFF4834R_chr00070.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtQQQxJ/XFF4834R_chr00070.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtQQQxJ/XFF4834R_chr00070.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.