Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr00060XFF4834R_chr00060494_0009300_f1_XFF4834R-XFF4834R_chr00060XFF4834R_chr00060putative peptidase

XFF4834R_chr00060494_0009300_f1_XFF4834R-XFF4834R_chr00060 XFF4834R_chr00060
XFF4834R_chr00050
XFF4834R_chr00050
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00070
XFF4834R_chr00070
ID XFF4834R_chr00060494_0009300_f1_XFF4834R-XFF4834R_chr00060
AC XFF4834R_chr00060
LT XFF4834R_chr00060
OR XFF4834R_chr from 8494 to 9300 on strand +
DE putative peptidase
IP Peptidase M48, Ste24p
CL 1.2.3 Proteins/peptides/glycopeptides GO:0006508 GO:0009050
EC
GO InterPro
Biological Process: proteolysis (GO:0006508)
Cellular Component: membrane (GO:0016020)
Molecular Function: metalloendopeptidase activity (GO:0004222)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: acur
CC STATUS: curated by darrasse (20120626)
MW 28387.1 Da
SQ 268 aa
 
........10........20........30........40........50
| | | | |
MKARLLIVVAVLALTACATTTSPTGRRQVVGGVSQQQLDQLGAQSFAQTK
GKEKVSTDGKQNAYVQCVVNALVAQLPPQWRETKWETALFVDNEANAFAL
PGGKVGVNTGIFTVAKTQDQLAAVLGHEIGHVISRHHEERITRQLGAQTG
LGIIGALAGAAYGDGAASAVNQVGGMTAQTVFLLPGSRTQESEADVVGQR
LMAQAGFDPAQAVTLWQNMMAASGNRQPQWLSTHPDPANRIRELQADVAQ
LEPVYQQAKQSGRAPRCG
XFF4834R

XFF4834R_chr10470 lcl|XFF4834R_chr11100237_1191943_r3_XFF4834R-XFF4834R_chr10470

89

252

S=159 I=29 E=7.21216e-13

XFF4834R

XFF4834R_chr10470 lcl|XFF4834R_chr11100237_1191943_r3_XFF4834R-XFF4834R_chr10470

89

252

S=159 I=29 E=7.21216e-13

X.species

NP_640362.1 lcl|XAC0006-XAC0006

1

268

S=1064 I=78 E=5.72026e-122

hypothetical protein

X.species

NP_635401.1 lcl|XCC0006

1

268

S=1022 I=75 E=6.96133e-117

hypothetical protein

X.species

YP_361737.1 lcl|XCV0006

1

255

S=987 I=77 E=1.25523e-112

putative peptidase precursor

X.species

lcl|XALc_0006

22

268

S=832 I=66 E=8.34526e-94

putative peptidase precursor protein

X.species

lcl|XALc_0576

84

243

S=172 I=30 E=7.80595e-14

putative zn-dependent protease protein

X.species

NP_641390.1 lcl|XAC1043-XAC1043

89

252

S=159 I=29 E=2.5307e-12

hypothetical protein

X.species

YP_362804.1 lcl|XCV1073

89

252

S=159 I=29 E=2.62052e-12

putative Zn-dependent protease

X.species

NP_636350.1 lcl|XCC0964

89

252

S=159 I=29 E=2.80983e-12

hypothetical protein

pubmed

1

268

S=1022 I=75 E=2.58517e-115

Putative uncharacterized protein Putative uncharacterized protein orf268 ; Hydrolase Metal-binding Metalloprotease Zinc

Pubmed 12646254

 

prodomImg

pubmed

84

261

S=203 I=27 E=4.86493e-16

Mitochondrial metalloendopeptidase OMA1 EC=3.4.24.- ; Hydrolase Membrane Metal-binding Metalloprotease Mitochondrion inner Transmembrane Zinc

Pubmed 8203164

 

prodomImg

pubmed

57

241

S=142 I=26 E=1.08814e-08

Zinc-dependent protease ; Hydrolase Metal-binding Metalloprotease

Pubmed 18492059

 

prodomImg

sp

82

245

S=258 I=38 E=6.71879e-23

Mitochondrial metalloendopeptidase OMA1 EC=3.4.24.- ; Hydrolase Membrane Metal-binding Metalloprotease Mitochondrion inner Transmembrane Zinc

 

prodomImg

sp

84

261

S=203 I=27 E=3.35443e-16

Mitochondrial metalloendopeptidase OMA1 EC=3.4.24.- ; Hydrolase Membrane Metal-binding Metalloprotease Mitochondrion inner Transmembrane Zinc

 

prodomImg

sp

65

250

S=194 I=31 E=4.469e-15

Metalloendopeptidase OMA1, mitochondrial EC=3.4.24.- ; Hydrolase Membrane Metal-binding Metalloprotease Mitochondrion Transit peptide Transmembrane Zinc

 

prodomImg

sp

78

266

S=189 I=31 E=1.51468e-14

Metalloendopeptidase OMA1, mitochondrial EC=3.4.24.- ; Alternative splicing Hydrolase Membrane Metal-binding Metalloprotease Mitochondrion Trans

 

prodomImg

sp

69

258

S=182 I=28 E=9.70168e-14

TPR repeat-containing protein yfgC ; Signal

 

prodomImg

Iprscan [PTHR22726]

84

251

-

Iprscan IPR001915 [PF01435]

33

243

Peptidase M48

Iprscan [PS51257]

1

17

-

Iprscan [seg]

5

21

-

Iprscan [seg]

28

42

-

Iprscan [seg]

145

169

-

Iprscan [SignalP-NN(euk)]

1

20

-

PD002296

48

143

S=167 I=39 E=9.52237e-13

PD404561

184

245

S=139 I=47 E=2.75176e-09

PDA47793

243

268

S=134 I=100 E=1.02653e-08

PDA2K276

243

268

S=107 I=77 E=1.74286e-05

PDA47784

245

268

S=104 I=79 E=3.68893e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one iv01aTqr)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

11 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrFjL66/XFF4834R_chr00060.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrFjL66/XFF4834R_chr00060.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrFjL66/XFF4834R_chr00060.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrFjL66/XFF4834R_chr00060.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.