Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr00040gyrBXFF4834R_chr00040DNA gyrase, subunit B

gyrB XFF4834R_chr00040
XFF4834R_chr00030
XFF4834R_chr00030
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00050
XFF4834R_chr00050
ID gyrB
AC XFF4834R_chr00040
LT XFF4834R_chr00040
OR XFF4834R_chr from 4961 to 7405 on strand +
DE DNA gyrase, subunit B
IP DNA topoisomerase, type IIA, subunit B; DNA topoisomerase, type IIA, subunit B or N-terminal; DNA topoisomerase, type IIA, subunit B, C-terminal; DNA topoisomerase, type IIA, subunit B, region 2; Ribosomal protein S5 domain 2-type fold
CL 2.1.1 DNA replication GO:0006261
EC
GO InterPro
Biological Process: DNA topological change (GO:0006265)
Cellular Component: chromosome (GO:0005694)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: acur
CC STATUS: curated by royer (20100323)
MW 89690.8 Da
SQ 814 aa
 
........10........20........30........40........50
| | | | |
MTDEQNTPPTPNGTYDSSKITVLRGLEAVRKRPGMYIGDVHDGTGLHHMV
FEVVDNSVDEALAGHADDIVVKIMADGSVAVSDNGRGVPVDIHKEEGVSA
AEVILTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSEHLWLDIWRDGFH
YQQEYALGEPQYPLKQLEASTKRGTTLRFKPSVAIFSDVEFHYDILARRL
RELSFLNSGVKITLIDERGEGRRDDFHYEGGIRSFVEHLAQLKSPLHPNV
ISVTGEHNGIMVDVALQWTDAYQETMYCFTNNIPQKDGGTHLAGFRAALT
RVLSTYIEQNGIAKQAKVALTGDDMREGMIAVLSVKVPDPSFSSQTKEKL
VSSDVRPAVENAFGARLQEFLQENPNEAKAITGKIVDAARAREAARKARD
LTRRKGALDIAGLPGKLADCQEKDPALSELFIVEGDSAGGSAKQGRNRKN
QAVLPLRGKILNVERARFDRMLSSDQVGTLITALGTGIGRDEYNPDKLRY
HRIILMTDADVDGSHIRTLLLTFFYRQMPELIERGYIYIGLPPLYKLKQG
KSELYLKDDAALNAYLASNAVEGAALIPATDEPPITGEALEKLLMLFTSA
NEAIARNAHRYDPALLTALIDLPPLDVEKLQAEGDQHPTLDALQAVLNRG
TLGTARYQLRFDPGSDNAPATLVAIRRHMGEEFTQVLPMGAFESGELRPL
REVSLALHDLVREGAQIVRGNKSHPITSFAQAHAWLLDEAKKGRQVQRFK
GLGEMNAEQLWETTVNPDTRRLLQVRIEDAVAADQIFSTLMGDVVEPRRD
FIEDNALKVSNLDI
XFF4834R

XFF4834R_chr27980 lcl|parE-XFF4834R_chr27980

12

559

S=809 I=36 E=5.13571e-91

DNA topoisomerase IV, subunit B

XFF4834R

XFF4834R_chr27980 lcl|parE-XFF4834R_chr27980

739

791

S=131 I=50 E=7.03829e-09

DNA topoisomerase IV, subunit B

XFF4834R

XFF4834R_chr27980 lcl|parE-XFF4834R_chr27980

12

559

S=809 I=36 E=5.13571e-91

DNA topoisomerase IV, subunit B

XFF4834R

XFF4834R_chr27980 lcl|parE-XFF4834R_chr27980

739

791

S=131 I=50 E=7.03829e-09

DNA topoisomerase IV, subunit B

pubmed

1

814

S=3505 I=81 E=0

DNA gyrase subunit B EC=5.99.1.3 ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 18268084

 

prodomImg

pubmed

1

621

S=2984 I=91 E=0

DNA gyrase subunit B EC=5.99.1.3 ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 12039751

 

prodomImg

pubmed

15

814

S=2425 I=58 E=0

DNA gyrase subunit B EC=5.99.1.3 ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 18400056

 

prodomImg

pubmed

15

814

S=2394 I=58 E=0

DNA gyrase subunit B EC=5.99.1.3 ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 9464408

 

prodomImg

pubmed

12

814

S=2373 I=57 E=0

DNA gyrase subunit B EC=5.99.1.3 ; Antibiotic resistance ATP-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 3020376,3029692

 

prodomImg

pubmed

10

814

S=2316 I=56 E=0

DNA gyrase subunit B EC=5.99.1.3 ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 16714566

 

prodomImg

pubmed

10

814

S=2288 I=56 E=0

DNA gyrase subunit B EC=5.99.1.3 ; Antibiotic resistance ATP-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 2170947,7793912

 

prodomImg

pubmed

1

814

S=2176 I=53 E=0

DNA gyrase subunit B EC=5.99.1.3 ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 16233838

 

prodomImg

pubmed

1

814

S=2131 I=53 E=0

DNA gyrase subunit B EC=5.99.1.3 ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 16885440

 

prodomImg

pubmed

15

813

S=1977 I=51 E=0

DNA gyrase subunit B EC=5.99.1.3 ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 1906260

 

prodomImg

sp

12

814

S=2417 I=58 E=0

DNA gyrase subunit B EC=5.99.1.3 ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

 

prodomImg

sp

15

814

S=2394 I=58 E=0

DNA gyrase subunit B EC=5.99.1.3 ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

 

prodomImg

sp

12

814

S=2374 I=57 E=0

DNA gyrase subunit B EC=5.99.1.3 ; Antibiotic resistance ATP-binding Isomerase Nucleotide-binding Topoisomerase

 

prodomImg

sp

12

814

S=2374 I=57 E=0

DNA gyrase subunit B EC=5.99.1.3 ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

 

prodomImg

sp

12

814

S=2373 I=57 E=0

DNA gyrase subunit B EC=5.99.1.3 ; Antibiotic resistance ATP-binding Isomerase Nucleotide-binding Topoisomerase

 

prodomImg

Iprscan IPR000565 [PR01159]

15

25

DNA topoisomerase, type IIA, subunit B

Iprscan IPR000565 [PR01159]

190

205

DNA topoisomerase, type IIA, subunit B

Iprscan IPR000565 [PR01159]

205

218

DNA topoisomerase, type IIA, subunit B

Iprscan IPR000565 [PR01159]

230

252

DNA topoisomerase, type IIA, subunit B

Iprscan IPR000565 [PR01159]

322

338

DNA topoisomerase, type IIA, subunit B

Iprscan IPR000565 [PR01159]

370

384

DNA topoisomerase, type IIA, subunit B

Iprscan IPR000565 [PR01159]

384

404

DNA topoisomerase, type IIA, subunit B

Iprscan IPR000565 [PR01159]

480

489

DNA topoisomerase, type IIA, subunit B

Iprscan IPR000565 [PR01159]

767

779

DNA topoisomerase, type IIA, subunit B

Iprscan IPR000565 [PR01159]

783

799

DNA topoisomerase, type IIA, subunit B

Iprscan IPR001241 [PR00418]

45

60

DNA topoisomerase, type IIA, subunit B/N-terminal

Iprscan IPR001241 [PR00418]

80

93

DNA topoisomerase, type IIA, subunit B/N-terminal

Iprscan IPR001241 [PR00418]

123

137

DNA topoisomerase, type IIA, subunit B/N-terminal

Iprscan IPR001241 [PR00418]

278

291

DNA topoisomerase, type IIA, subunit B/N-terminal

Iprscan IPR001241 [PR00418]

430

444

DNA topoisomerase, type IIA, subunit B/N-terminal

Iprscan IPR001241 [PR00418]

497

513

DNA topoisomerase, type IIA, subunit B/N-terminal

Iprscan IPR001241 [PR00418]

515

532

DNA topoisomerase, type IIA, subunit B/N-terminal

Iprscan IPR001241 [PR00418]

535

547

DNA topoisomerase, type IIA, subunit B/N-terminal

Iprscan IPR001241 [PR00418]

746

762

DNA topoisomerase, type IIA, subunit B/N-terminal

Iprscan IPR003594 [G3DSA:3.30.565.10]

12

230

ATPase-like, ATP-binding domain

Iprscan IPR013759 [G3DSA:3.40.50.670]

394

786

DNA topoisomerase, type IIA, subunit B/N-terminal, alpha-beta

Iprscan [PTHR10169]

34

813

-

Iprscan IPR013506 [PF00204]

231

400

DNA topoisomerase, type IIA, subunit B, domain 2

Iprscan IPR002288 [PF00986]

741

803

DNA topoisomerase, type IIA, subunit B, C-terminal

Iprscan IPR003594 [PF02518]

42

181

ATPase-like, ATP-binding domain

Iprscan IPR003594 [SM00387]

41

185

ATPase-like, ATP-binding domain

Iprscan IPR001241 [SM00433]

45

807

DNA topoisomerase, type IIA, subunit B/N-terminal

Iprscan IPR011557 [TIGR01059]

15

814

DNA gyrase, subunit B

Iprscan [seg]

121

133

-

Iprscan [seg]

388

399

-

Iprscan [seg]

478

489

-

PD001260

292

417

S=261 I=49 E=4.87944e-24

PD809816

418

472

S=229 I=78 E=3.52224e-20

PD588435

134

237

S=189 I=49 E=2.89536e-15

PD689532

555

629

S=184 I=55 E=1.02505e-14

PD149633

506

545

S=182 I=83 E=1.74471e-14

PDA1I6P8

13

90

S=182 I=45 E=2.13212e-14

PD706927

715

770

S=169 I=56 E=6.1181e-13

PDA1F6N0

772

814

S=162 I=74 E=5.45794e-12

PD111460

505

630

S=156 I=37 E=3.01428e-11

PD779506

73

115

S=151 I=66 E=1.18486e-10

Iprscan IPR013760 [SSF56719]

404

806

DNA topoisomerase, type IIA, central

Iprscan IPR003594 [SSF55874]

14

229

ATPase-like, ATP-binding domain

Iprscan IPR020568 [SSF54211]

231

402

Ribosomal protein S5 domain 2-type fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one dm9sH7gg)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

253 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

34 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdOIbMx/XFF4834R_chr00040.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdOIbMx/XFF4834R_chr00040.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdOIbMx/XFF4834R_chr00040.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdOIbMx/XFF4834R_chr00040.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.