Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr00030recFXFF4834R_chr00030recombination protein F

recF XFF4834R_chr00030
XFF4834R_chr_0004
XFF4834R_chr_0004
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00040
XFF4834R_chr00040
ID recF
AC XFF4834R_chr00030
LT XFF4834R_chr00030
OR XFF4834R_chr from 3740 to 4846 on strand +
DE recombination protein F
IP DNA-binding, RecF; RecF/RecN/SMC protein, N-terminal
CL 2.1.3 DNA recombination GO:0006310
EC
GO InterPro
Biological Process: DNA repair (GO:0006281)
Cellular Component: chromosome (GO:0005694)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: single-stranded DNA binding (GO:0003697)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: acur
CC STATUS: curated by royer (20100323)
MW 40512.6 Da
SQ 368 aa
 
........10........20........30........40........50
| | | | |
MHVVRLSIHRLRRFQTVELHPSSALNLLTGDNGAGKTSVLEALHLMAYGR
SFRGRVRDGLIQQGANDLEVFVEWKEGGGAAGERTRRAGLRHSGQEWTGR
LDGEDVAQLGSLCAALAVVTFEPGSHVLISGGGEPRRRFLDWGLFHVEPD
FLTLWRRYARALKQRNALLKQGAQPRLLDAWDNELAESGENLTSRRMRYL
ERLQDRMVPVADAIAPALGLSALTFAPGWKRHEVSLADALLLARDRDRQN
GYTSPGPHRADWMPSFLALPGKDALSRGQAKLTALACLLAQAEDFAFERG
EWPVIALDDLGSELDRHHQGRVLQRLASAPAQVLITATETPPGLADAAAL
LQQFHVEHGQIARQVAAN
pubmed

1

368

S=1539 I=80 E=9.59352e-178

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 12039751

 

prodomImg

pubmed

1

361

S=442 I=33 E=8.21882e-45

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 2172087

 

prodomImg

pubmed

1

362

S=438 I=33 E=2.25966e-44

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 6379647,6089112

 

prodomImg

pubmed

1

362

S=428 I=32 E=3.49146e-43

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 1542576

 

prodomImg

pubmed

1

337

S=409 I=33 E=8.19141e-41

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 1741300

 

prodomImg

pubmed

1

363

S=405 I=33 E=2.37308e-40

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 1542576,2540413

 

prodomImg

pubmed

1

362

S=297 I=28 E=2.67544e-27

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 18281406

 

prodomImg

pubmed

1

338

S=283 I=28 E=1.62495e-25

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 10427704

 

prodomImg

pubmed

1

338

S=276 I=26 E=1.16571e-24

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 7898435,1311298

 

prodomImg

pubmed

1

340

S=270 I=24 E=4.9562e-24

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

Pubmed 17592475

 

prodomImg

sp

1

368

S=1710 I=90 E=0

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

 

prodomImg

sp

1

368

S=1654 I=87 E=0

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

 

prodomImg

sp

1

368

S=1612 I=85 E=0

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

 

prodomImg

sp

1

361

S=1601 I=85 E=0

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

 

prodomImg

sp

1

368

S=1545 I=80 E=1.15425e-178

DNA replication and repair protein recF ; ATP-binding Cytoplasm damage DNA-binding Nucleotide-binding SOS response

 

prodomImg

Iprscan [G3DSA:3.40.50.300]

1

66

-

Iprscan IPR003395 [PF02463]

3

340

RecF/RecN/SMC protein, N-terminal

Iprscan IPR001238 [TIGR00611]

1

361

DNA-binding, RecF

Iprscan [seg]

76

89

-

Iprscan [seg]

236

248

-

PDA1K1O4

168

234

S=297 I=84 E=1.70132e-28

PD003952

47

167

S=164 I=38 E=2.19971e-12

PD358672

249

362

S=163 I=38 E=2.9076e-12

Iprscan [SSF52540]

1

337

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one L748lUWx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

43 hits
swiss-prot

Swiss-Prot ncbi-blastp

386 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBImbyjp/XFF4834R_chr00030.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBImbyjp/XFF4834R_chr00030.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBImbyjp/XFF4834R_chr00030.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBImbyjp/XFF4834R_chr00030.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.