Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr00020dnaNXFF4834R_chr00020DNA polymerase III, beta subunit

dnaN XFF4834R_chr00020
XFF4834R_chr00020
XFF4834R_chr00020
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0003
XFF4834R_chr_0003
ID dnaN
AC XFF4834R_chr00020
LT XFF4834R_chr00020
OR XFF4834R_chr from 1606 to 2706 on strand +
DE DNA polymerase III, beta subunit
IP DNA polymerase III, beta chain
CL 2.1.1 DNA replication GO:0006261
EC
GO InterPro
Biological Process: DNA replication (GO:0006260)
Molecular Function: DNA-directed DNA polymerase activity (GO:0003887)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: 3'-5' exonuclease activity (GO:0008408)

Curated
PM
AN DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. The beta chain is required for initiation of replication from an RNA primer, nucleotide triphosphate (dNTP) residues being added to the 5'-end of the growing DNA chain.
CC COG: [L] Replication, recombination and repair;
CC MODEL: acur
CC STATUS: curated by darrasse (20120313)
MW 40752.1 Da
SQ 366 aa
 
........10........20........30........40........50
| | | | |
MRFTLQREAFLKPLAQVVNVVERRQTLPVLANLLVQVKDGQVSLTGTDLE
VEMISRTLVEDAQDGETTIPARKLFDILRALPDGSRVTISQTGDKVTVQA
GRSRFTLATLPSNDFPSVDEVEATERVVVPEAGLKELIERTAFAMAQQDV
RYYLNGLLFDLRDGLLRCVATDGHRLALCEMELEKAGGAKRQIIVPRKGV
TELQRLLEGADREVELEVGRSHIRVKRGDVTFTSKLIDGRFPDYEAVIPI
GADREVKVDREALRASLQRAAILSNEKYRGVRVEVSPGQLKISAHNPEQE
EAQEEIEADTKVDDLAIGFNVNYLLDALSALRDEHVVIQLRDANSSALVR
EASSEKSRHVVMPLRL
pubmed

1

366

S=1662 I=89 E=0

DNA polymerase III beta chain ; Cytoplasm replication DNA-directed Nucleotidyltransferase

Pubmed 12039751

 

prodomImg

pubmed

1

366

S=957 I=52 E=3.2642e-107

DNA polymerase III subunit beta EC=2.7.7.7 ; Cytoplasm replication DNA-directed Nucleotidyltransferase

Pubmed 2540413

 

prodomImg

pubmed

1

366

S=909 I=48 E=1.99322e-101

DNA polymerase III subunit beta EC=2.7.7.7 ; Cytoplasm replication DNA-directed Nucleotidyltransferase

Pubmed 3040670

 

prodomImg

pubmed

1

366

S=896 I=47 E=7.11251e-100

DNA polymerase III subunit beta EC=2.7.7.7 ; Cytoplasm replication DNA-directed Nucleotidyltransferase

Pubmed 6234204,7686882

 

prodomImg

pubmed

1

366

S=847 I=46 E=5.79105e-94

DNA polymerase III subunit beta EC=2.7.7.7 ; Cytoplasm replication DNA-directed Nucleotidyltransferase

Pubmed 2172087

 

prodomImg

pubmed

6

366

S=737 I=42 E=1.46888e-80

DnaN ; Cytoplasm replication DNA-directed polymerase Nucleotidyltransferase

Pubmed 16233838

 

prodomImg

pubmed

1

366

S=602 I=36 E=3.20445e-64

DNA polymerase III subunit beta EC=2.7.7.7 ; Cytoplasm replication DNA-directed Nucleotidyltransferase

Pubmed 9079919,8226640

 

prodomImg

pubmed

1

365

S=589 I=32 E=1.13353e-62

DNA polymerase III beta subunit ; Cytoplasm replication DNA-directed Nucleotidyltransferase

Pubmed 11133977

 

prodomImg

pubmed

1

365

S=576 I=32 E=4.65035e-61

DNA polymerase III beta subunit ; Cytoplasm replication DNA-directed Nucleotidyltransferase

Pubmed 11133977

 

prodomImg

pubmed

1

365

S=570 I=30 E=2.10161e-60

DNA polymerase III beta subunit ; Cytoplasm replication DNA-directed Nucleotidyltransferase

Pubmed 11133977

 

prodomImg

sp

1

366

S=957 I=52 E=2.24606e-107

DNA polymerase III subunit beta EC=2.7.7.7 ; Cytoplasm replication DNA-directed Nucleotidyltransferase

 

prodomImg

sp

1

366

S=957 I=52 E=2.24606e-107

DNA polymerase III subunit beta EC=2.7.7.7 ; Cytoplasm replication DNA-directed Nucleotidyltransferase

 

prodomImg

sp

1

366

S=951 I=52 E=1.05107e-106

DNA polymerase III subunit beta EC=2.7.7.7 ; Cytoplasm replication DNA-directed Nucleotidyltransferase

 

prodomImg

sp

1

366

S=909 I=48 E=1.37152e-101

DNA polymerase III subunit beta EC=2.7.7.7 ; Cytoplasm replication DNA-directed Nucleotidyltransferase

 

prodomImg

sp

1

366

S=896 I=47 E=4.89405e-100

DNA polymerase III subunit beta EC=2.7.7.7 ; Cytoplasm replication DNA-directed Nucleotidyltransferase

 

prodomImg

Iprscan IPR001001 [G3DSA:3.10.150.10]

1

122

DNA polymerase III, beta chain

Iprscan IPR001001 [G3DSA:3.10.150.10]

127

248

DNA polymerase III, beta chain

Iprscan IPR001001 [G3DSA:3.10.150.10]

248

366

DNA polymerase III, beta chain

Iprscan IPR001001 [PF00712]

1

118

DNA polymerase III, beta chain

Iprscan IPR001001 [PF02767]

129

243

DNA polymerase III, beta chain

Iprscan IPR001001 [PF02768]

246

365

DNA polymerase III, beta chain

Iprscan IPR001001 [SM00480]

17

362

DNA polymerase III, beta chain

Iprscan IPR001001 [TIGR00663]

1

366

DNA polymerase III, beta chain

Iprscan [seg]

154

167

-

Iprscan [seg]

298

308

-

PDA1F771

193

244

S=161 I=59 E=4.66396e-12

PDA1L6Q1

179

296

S=144 I=29 E=5.59173e-10

PD822108

247

296

S=144 I=57 E=6.71526e-10

PD806656

1

48

S=139 I=53 E=2.25625e-09

PDA5C2B6

24

116

S=135 I=34 E=6.82768e-09

PD256123

55

109

S=135 I=52 E=6.94778e-09

PD343696

110

180

S=134 I=43 E=1.04667e-08

PDA4K6Y1

1

108

S=124 I=35 E=1.6032e-07

PDA015L6

134

366

S=119 I=23 E=5.77569e-07

PD858454

309

366

S=118 I=45 E=8.5506e-07

Iprscan [SSF55979]

245

366

-

Iprscan [SSF55979]

122

244

-

Iprscan [SSF55979]

1

121

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one rWo22e7z)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

69 hits
swiss-prot

Swiss-Prot ncbi-blastp

58 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB971W6s/XFF4834R_chr00020.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB971W6s/XFF4834R_chr00020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB971W6s/XFF4834R_chr00020.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB971W6s/XFF4834R_chr00020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.