Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr00010dnaAXFF4834R_chr00010chromosomal replication initiator protein DnaA

dnaA XFF4834R_chr00010

Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00020
XFF4834R_chr00020
ID dnaA
AC XFF4834R_chr00010
LT XFF4834R_chr00010
OR XFF4834R_chr from 1 to 1329 on strand +
DE chromosomal replication initiator protein DnaA
IP Chromosomal replication control, initiator DnaA; Trp repressor/replication initiator; Chromosomal replication control, initiator (DnaA)/regulator (Hda)
CL 2.1.1 DNA replication GO:0006261
EC
GO InterPro
Biological Process: DNA replication initiation (GO:0006270)
Biological Process: regulation of DNA replication (GO:0006275)
Molecular Function: nucleoside-triphosphatase activity (GO:0017111)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: DNA replication origin binding (GO:0003688)
Molecular Function: nucleotide binding (GO:0000166)
Molecular Function: sequence-specific DNA binding (GO:0043565)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: acur
CC STATUS: curated by royer (20100323)
MW 49572.2 Da
SQ 442 aa
 
........10........20........30........40........50
| | | | |
MDAWPRCLERLEAEFPPEDVHTWLKPLQAEDRGDSIVLYAPNAFIVDQVR
ERYLPRIRELLAYFAGNGEVALAVGSRPRAPEPAPAPVAVMSAPQAAPIV
PFAGNLDSHYTFANFVEGRSNQLGLAAAIQAAQKPGERAHNPLLLYGSTG
LGKTHLMFAAGNALRQANPAAKVMYLRSEQFFSAMIRALQDKAMDQFKRQ
FQQIDALLIDDIQFFAGKDRTQEEFFHTFNALFDGRQQIILTCDRYPREV
EGLEPRLKSRLAWGLSVAIDPPDFETRAAIVLAKARERGAEIPDDVAFLI
AKKMRSNVRDLEGALNTLVARANFTGRSITVEFAQETLRDLLRAQQQAIG
IPNIQKTVADYYGLQMKDLLSKRRTRSLARPRQVAMALAKELTEHSLPEI
GDAFAGRDHTTVLHACRQIRTLMEADGKLREDWEKLIRKLSE
pubmed

1

442

S=2117 I=93 E=0

Chromosomal replication initiator protein dnaA ; ATP-binding Cytoplasm DNA-binding Nucleotide-binding

Pubmed 12039751

 

prodomImg

pubmed

104

441

S=1151 I=62 E=1.36441e-130

Chromosomal replication initiator protein dnaA ; ATP-binding Cytoplasm DNA-binding Nucleotide-binding

Pubmed 11948168

 

prodomImg

pubmed

16

77

S=134 I=42 E=1.98881e-07

Chromosomal replication initiator protein dnaA ; ATP-binding Cytoplasm DNA-binding Nucleotide-binding

Pubmed 11948168

 

prodomImg

pubmed

4

441

S=1145 I=50 E=7.40503e-130

Chromosomal replication initiator protein dnaA ; ATP-binding Cytoplasm DNA-binding Nucleotide-binding

Pubmed 1572539,9516544

 

prodomImg

pubmed

102

441

S=1134 I=61 E=1.55245e-128

Chromosomal replication initiator protein dnaA ; ATP-binding Cytoplasm DNA-binding Nucleotide-binding

Pubmed 2172087

 

prodomImg

pubmed

1

67

S=170 I=43 E=8.49116e-12

Chromosomal replication initiator protein dnaA ; ATP-binding Cytoplasm DNA-binding Nucleotide-binding

Pubmed 2172087

 

prodomImg

pubmed

102

441

S=1132 I=61 E=2.20028e-128

Chromosomal replication initiator protein dnaA ; ATP-binding Cytoplasm DNA-binding Nucleotide-binding

Pubmed 3040670

 

prodomImg

pubmed

1

66

S=169 I=44 E=1.32458e-11

Chromosomal replication initiator protein dnaA ; ATP-binding Cytoplasm DNA-binding Nucleotide-binding

Pubmed 3040670

 

prodomImg

pubmed

102

441

S=1132 I=61 E=2.29832e-128

Chromosomal replication initiator protein dnaA ; ATP-binding Cytoplasm DNA-binding Nucleotide-binding

Pubmed 6296774,6234204

 

prodomImg

pubmed

1

66

S=170 I=44 E=8.94718e-12

Chromosomal replication initiator protein dnaA ; ATP-binding Cytoplasm DNA-binding Nucleotide-binding

Pubmed 6296774,6234204

 

prodomImg

sp

1

442

S=2152 I=93 E=0

Chromosomal replication initiator protein dnaA ; ATP-binding Cytoplasm DNA-binding Nucleotide-binding

 

prodomImg

sp

1

442

S=2149 I=93 E=0

Chromosomal replication initiator protein dnaA ; ATP-binding Cytoplasm DNA-binding Nucleotide-binding

 

prodomImg

sp

1

442

S=2148 I=93 E=0

Chromosomal replication initiator protein dnaA ; ATP-binding Cytoplasm DNA-binding Nucleotide-binding

 

prodomImg

sp

1

442

S=2148 I=93 E=0

Chromosomal replication initiator protein dnaA ; ATP-binding Cytoplasm DNA-binding Nucleotide-binding

 

prodomImg

sp

1

442

S=2145 I=93 E=0

Chromosomal replication initiator protein dnaA ; ATP-binding Cytoplasm DNA-binding Nucleotide-binding

 

prodomImg

Iprscan [coil]

301

322

-

Iprscan IPR020591 [PR00051]

140

160

Chromosomal replication control, initiator DnaA-like

Iprscan IPR020591 [PR00051]

172

186

Chromosomal replication control, initiator DnaA-like

Iprscan IPR020591 [PR00051]

204

218

Chromosomal replication control, initiator DnaA-like

Iprscan IPR020591 [PR00051]

238

265

Chromosomal replication control, initiator DnaA-like

Iprscan IPR020591 [PR00051]

400

419

Chromosomal replication control, initiator DnaA-like

Iprscan [G3DSA:3.40.50.300]

103

271

-

Iprscan [G3DSA:1.10.1750.10]

337

440

-

Iprscan IPR013317 [PF00308]

107

324

Chromosomal replication control, initiator (DnaA)/regulator (Hda)

Iprscan IPR013159 [PF08299]

351

419

Chromosomal replication initiator, DnaA C-terminal

Iprscan IPR003593 [SM00382]

139

270

ATPase, AAA+ type, core

Iprscan IPR013159 [SM00760]

350

419

Chromosomal replication initiator, DnaA C-terminal

Iprscan IPR001957 [TIGR00362]

4

440

Chromosomal replication control, initiator DnaA

Iprscan [seg]

78

98

-

Iprscan [seg]

126

133

-

PD002717

221

330

S=324 I=58 E=9.23346e-32

PD548885

343

436

S=308 I=63 E=9.62879e-30

PD066439

159

223

S=178 I=48 E=4.4112e-14

PD106718

1

77

S=172 I=42 E=2.82541e-13

PD994759

170

338

S=163 I=29 E=3.16187e-12

PD338667

105

157

S=145 I=54 E=4.59239e-10

PD901532

106

173

S=110 I=38 E=7.85871e-06

Iprscan [SSF52540]

104

319

-

Iprscan IPR010921 [SSF48295]

336

442

Trp repressor/replication initiator

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one dhjJWHaj)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

187 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

17 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBOSLGnV/XFF4834R_chr00010.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBOSLGnV/XFF4834R_chr00010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBOSLGnV/XFF4834R_chr00010.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBOSLGnV/XFF4834R_chr00010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.