Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr01980XFF4834R_chr02100777_0236529_f1_XFF4834R-XFF4834R_chr01980XFF4834R_chr01980conserved hypothetical protein
  2. XFF4834R_chr07400XFF4834R_chr07820529_0857104_f2_XFF4834R-XFF4834R_chr07400XFF4834R_chr07400conserved hypothetical protein
  3. XFF4834R_chr21450ornXFF4834R_chr21450probable oligoribonuclease

XFF4834R_chr02100777_0236529_f1_XFF4834R-XFF4834R_chr01980 XFF4834R_chr01980
XFF4834R_chr01970
XFF4834R_chr01970
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr01990
XFF4834R_chr01990
ID XFF4834R_chr02100777_0236529_f1_XFF4834R-XFF4834R_chr01980
AC XFF4834R_chr01980
LT XFF4834R_chr01980
OR XFF4834R_chr from 235777 to 236529 on strand +
DE conserved hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN Seems to have a cleavable N-term signal seq
CC COG: [AS] RNA processing and modification;Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100802)
MW 25264.8 Da
SQ 250 aa
 
........10........20........30........40........50
| | | | |
MMRQTVLAIALACTIGAAAAQVAAPPPPPAPNGPIGGPPAPPTPVAATPV
SVSGTVERFLLNPNGDVDGLWLRDGTQVGFPPHLSSEVKAAVRAGDSVVV
KGFRLGNLPVLQVSSIRSGRSGREVVDRPPTFGAAPPPPPTPGQLTPLQS
DGTIHRLVYGPAGEVNGALVSDGTVVRMPPHLALQFADLLRVGAPLSASG
LGVATPDGRAIEATQLGRDRSSLRALFTAPRPDGPLPPPPPGAPVPPAGR
XFF4834R

XFF4834R_chr01990 lcl|XFF4834R_chr_0236632_0237249_f1_XFF4834R-XFF4834R_chr01990

51

226

S=266 I=36 E=7.43425e-26

X.species

NP_640583.1 lcl|XAC0227-XAC0227

50

228

S=766 I=87 E=6.15226e-86

hypothetical protein

X.species

YP_361964.1 lcl|XCV0233

50

228

S=756 I=86 E=1.19247e-84

putative secreted protein

X.species

lcl|XALc_2597

50

227

S=534 I=59 E=9.21337e-58

conserved hypothetical protein

X.species

YP_361965.1 lcl|XCV0234

51

226

S=266 I=36 E=2.40264e-25

hypothetical protein

X.species

NP_640584.1 lcl|XAC0228-XAC0228

51

226

S=266 I=36 E=2.64447e-25

hypothetical protein

Iprscan [seg]

7

49

-

Iprscan [seg]

129

149

-

Iprscan [seg]

229

249

-

Iprscan [SignalP-NN(euk)]

1

20

-

PDA1J4Z0

150

227

S=254 I=68 E=2.82285e-23

PD605008

54

102

S=166 I=63 E=1.1902e-12

PDA2D6S8

103

128

S=124 I=100 E=1.28199e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one jBL0hC09)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjPrBLJ/XFF4834R_chr01980.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjPrBLJ/XFF4834R_chr01980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjPrBLJ/XFF4834R_chr01980.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjPrBLJ/XFF4834R_chr01980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr07820529_0857104_f2_XFF4834R-XFF4834R_chr07400 XFF4834R_chr07400
XFF4834R_chr07390
XFF4834R_chr07390
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07410
XFF4834R_chr07410
ID XFF4834R_chr07820529_0857104_f2_XFF4834R-XFF4834R_chr07400
AC XFF4834R_chr07400
LT XFF4834R_chr07400
OR XFF4834R_chr from 856376 to 857104 on strand +
DE conserved hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN
CC COG: [AS] RNA processing and modification;Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100802)
MW 24860.9 Da
SQ 242 aa
 
........10........20........30........40........50
| | | | |
MPASANPRRRAARGGKCAAQSAATLPGRARPSPRPPSACRAQMCHPAREI
TMVHAPPRVVVTTAILAALNLAGCANFCGAAHHAPVPYAHREPPPPPPGA
RNIDALPACAPEHDVVPALPADVARRAAPERQDRESVDGCLVHRGVAPPP
PPPFDGDAFDAPDAADGPPDLPPDDSEFDAALQACATAEGIAAPFPQAPS
PDLPPDLLAECLDAAGFAPPPPPPPPPPLPLPLPLPPFQPPR
X.species

NP_641085.1 lcl|XAC0732-XAC0732

20

218

S=540 I=63 E=1.4214e-58

hypothetical protein

X.species

YP_362517.1 lcl|XCV0786

20

218

S=499 I=59 E=1.64163e-53

hypothetical protein

Iprscan [seg]

2

19

-

Iprscan [seg]

28

41

-

Iprscan [seg]

93

98

-

Iprscan [seg]

147

175

-

Iprscan [seg]

193

209

-

Iprscan [seg]

219

241

-

PD670506

20

218

S=496 I=58 E=1.22498e-52

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one WFKJ3M1v)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjPrBLJ/XFF4834R_chr07400.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjPrBLJ/XFF4834R_chr07400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjPrBLJ/XFF4834R_chr07400.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjPrBLJ/XFF4834R_chr07400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
orn XFF4834R_chr21450
XFF4834R_chr21440
XFF4834R_chr21440
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr21460
XFF4834R_chr21460
ID orn
AC XFF4834R_chr21450
LT XFF4834R_chr21450
OR XFF4834R_chr from 2487146 to 2487730 on strand +
DE probable oligoribonuclease
IP Polynucleotidyl transferase, ribonuclease H fold; Exonuclease, RNase T/DNA polymerase III
CL 2.2.4 RNA degradation GO:0006401
EC
GO InterPro
Cellular Component: intracellular (GO:0005622)
Molecular Function: nucleic acid binding (GO:0003676)
Molecular Function: exonuclease activity (GO:0004527)

Curated
PM
AN
CC COG: [A] RNA processing and modification;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100802)
MW 21929.4 Da
SQ 194 aa
 
........10........20........30........40........50
| | | | |
MAENLAGNDRLIWIDLEMTGLDTDRDSIIEIATIVTDAQLNVLAEGPELA
IAHPLETLEAMDEWNRNQHRRSGLWQRVLDSQVTHAQAEAQTVAFLSEWI
RAGASPMCGNSICQDRRFLHRQMSRLERYFHYRNLDVSTIKELARRWAPT
VANGFAKSSAHTALSDVRDSIDELRHYRQFMGALGGDTQADVPA
X.species

NP_642365.1 lcl|orn-XAC2039

1

192

S=1004 I=98 E=7.87495e-115

oligoribonuclease

X.species

YP_363931.1 lcl|orn-XCV2200

1

181

S=959 I=99 E=1.87536e-109

oligoribonuclease

X.species

NP_637524.1 lcl|orn-XCC2168

1

181

S=938 I=97 E=6.23587e-107

oligoribonuclease

X.species

lcl|orn-XALc_1647

1

186

S=863 I=85 E=8.54542e-98

probable oligoribonuclease protein

pubmed

16

179

S=483 I=52 E=3.17829e-50

Putative oligoribonuclease ; Plasmid

Pubmed 12673061

 

prodomImg

pubmed

8

188

S=439 I=49 E=7.43801e-45

Oligoribonuclease EC=3.1.-.- ; Cytoplasm Exonuclease Hydrolase

Pubmed 10913103

 

prodomImg

pubmed

8

189

S=436 I=49 E=1.64448e-44

Oligoribonuclease EC=3.1.-.- ; Cytoplasm Exonuclease Hydrolase

Pubmed 10540289,10913103

 

prodomImg

pubmed

1

178

S=430 I=44 E=9.24181e-44

Oligoribonuclease, mitochondrial EC=3.1.-.- ; Alternative splicing Exonuclease Hydrolase Manganese Mitochondrion Nucleus Phosphoprotein Transit

Pubmed 10810093

 

prodomImg

pubmed

1

178

S=429 I=45 E=1.27602e-43

Oligoribonuclease, mitochondrial EC=3.1.-.- ; Exonuclease Hydrolase Manganese Mitochondrion Phosphoprotein Transit peptide

Pubmed 17947660

 

prodomImg

sp

1

192

S=1004 I=98 E=2.05003e-113

Oligoribonuclease EC=3.1.-.- ; Cytoplasm Exonuclease Hydrolase

 

prodomImg

sp

1

192

S=998 I=98 E=8.79237e-113

Oligoribonuclease EC=3.1.-.- ; Cytoplasm Exonuclease Hydrolase

 

prodomImg

sp

1

192

S=998 I=98 E=8.79237e-113

Oligoribonuclease EC=3.1.-.- ; Cytoplasm Exonuclease Hydrolase

 

prodomImg

sp

1

181

S=959 I=99 E=4.88199e-108

Oligoribonuclease EC=3.1.-.- ; Cytoplasm Exonuclease Hydrolase

 

prodomImg

sp

1

181

S=938 I=97 E=1.62334e-105

Oligoribonuclease EC=3.1.-.- ; Cytoplasm Exonuclease Hydrolase

 

prodomImg

Iprscan [G3DSA:3.30.420.10]

2

185

-

Iprscan [MF_00045]

6

184

-

Iprscan [PTHR11046]

1

181

-

Iprscan IPR013520 [PF00929]

11

173

Exonuclease, RNase T/DNA polymerase III

Iprscan IPR006055 [SM00479]

10

183

Exonuclease

PD011165

47

159

S=354 I=58 E=1.77067e-35

PD477405

11

46

S=155 I=83 E=2.70735e-11

PDA1T0K4

160

181

S=115 I=100 E=1.66906e-06

Iprscan IPR012337 [SSF53098]

8

185

Polynucleotidyl transferase, ribonuclease H fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Jt4wfHh2)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

170 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjPrBLJ/XFF4834R_chr21450.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjPrBLJ/XFF4834R_chr21450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjPrBLJ/XFF4834R_chr21450.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjPrBLJ/XFF4834R_chr21450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.